Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR424 IGR425 IGR422 IGR423 IGR421 IGR426 IGR427 IGR419 IGR420 HD0609 HD0600 HD0607 gloA, - HD0610 dksA, - HD0603 folK, - HD0605 rnt, - HD0611 tbpA, - HD0601 pcnB, - HD0604 HD0609 HD0600 HD0607 gloA, - HD0610 dksA, - HD0603 folK, - HD0605 rnt, - HD0611 tbpA, - HD0601 pcnB, - HD0604 HD0600 HD0607 HD0608 HD0606 HD0606 HD0609 HD0608 gloA, - HD0610 dksA, - HD0603 folK, - HD0605 rnt, - HD0611 tbpA, - HD0601 pcnB, - HD0604 HD0602 HD0602
* Calculated from Protein Sequence

Gene ID: HD0605

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
folK  

Definition:
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase

Gene Start:
465544

Gene Stop:
466035

Gene Length:
492

Molecular Weight*:
18579

pI*:
5.80

Net Charge*:
-1.57

EC:
2.7.6.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table
Folate biosynthesis

Secondary Evidence:
Talarico,T.L., Dev,I.K., Dallas,W.S., Ferone,R. and Ray,P.H.
Purification and partial characterization of
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase and
7,8-dihydropteroate synthase from Escherichia coli MC4100
Journal of bacteriology. 173 (21), 7029-7032 (1991)
MEDLINE: 92041593


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinases; e.g., residues 3-155 are 59% similar to HPPK_HAEIN [1170357], residues 3-146 are 54% similar to HPPK_ECOLI [123493], and residues 7-135 are 45% similar to HPPK_BACSU [585263].

COGS Summary:  COGS Search
BeTs to 9 clades of COG0801
COG name: 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Functional Class:  H
The phylogenetic pattern of COG0801 is ----yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000550 (7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase) with a combined E-value of 1.4e-39.
    IPB000550A    6-20
    IPB000550B    51-74
    IPB000550C    78-101
    IPB000550D    111-128


ProDom Summary:  Protein Domain Search
Residues 3-99 are 37% similar to a (PYROPHOSPHOKINASE BIOSYN) protein domain (PD282817) which is seen in HPPK_MYCLE.

Residues 3-118 are 63% similar to a (PYROPHOSPHOKINASE FOLATE) protein domain (PD003866) which is seen in HPPK_HAEIN.

Residues 6-128 are 33% similar to a (PYROPHOSPHOKINASE BIOSYN) protein domain (PD339029) which is seen in HPPK_HELPJ.

Residues 3-137 are 34% similar to a (PROTEOME COMPLETE PA0583) protein domain (PD339218) which is seen in Q9KUJ5_VIBCH.



Paralogs:  Local Blast Search


HD0605 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 132 (E-value = 1.9e-58) place HD0605 in the HPPK family which is described as 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) (PF01288)

PDB Hit:
pdb|1CBK|A Chain A, 7,8-Dihydro-6-Hydroxymethylpterin-Pyrophosp... 187 7e-049
pdb|1DY3|A Chain A, Ternary Complex Of 7,8-Dihydro-6-Hydroxymet... 154 7e-039

Gene Protein Sequence:
VKMKTVYIALGSNLNNPLIQLRQAVASLQQFAVNLEVSPFYCSQPIGPQD
QPDYVNAVAKMETNLTAFQLLDQLQAIEQQQGRVRLRRWGERTLDLDILL
YANEQIKTDRLTVPHIEMKNRVFVIVPLYDLAPQLVLPSGEKLADIYALF
KDHTMQILSQSEN$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAAATGAAGACAGTTTATATTGCGTTAGGATCAAATCTGAATAATCC
ATTAATTCAGCTTAGGCAAGCGGTCGCTTCTTTGCAACAATTTGCCGTAA
ATCTTGAAGTGAGTCCTTTTTATTGTAGTCAGCCAATAGGGCCACAAGAT
CAGCCGGATTATGTTAATGCAGTCGCAAAAATGGAAACTAATTTGACCGC
TTTTCAGTTGTTAGATCAATTACAAGCGATAGAACAACAGCAAGGGCGTG
TTCGATTACGCCGTTGGGGAGAACGAACCTTAGACTTGGATATTTTGCTT
TATGCGAATGAACAGATCAAAACCGATCGTTTGACTGTGCCACATATTGA
AATGAAAAATAGGGTATTTGTGATTGTGCCATTATATGATTTAGCGCCTC
AGTTAGTCTTGCCAAGCGGTGAAAAATTAGCGGATATTTACGCGCTTTTT
AAAGATCATACCATGCAGATCCTATCGCAGTCAGAAAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy