Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR424 IGR425 IGR422 IGR423 IGR421 IGR419 IGR420 HD0609 HD0600 aspS, - HD0599 HD0607 dksA, - HD0603 folK, - HD0605 tbpA, - HD0601 pcnB, - HD0604 HD0609 HD0600 aspS, - HD0599 HD0607 dksA, - HD0603 folK, - HD0605 tbpA, - HD0601 pcnB, - HD0604 HD0600 aspS, - HD0599 HD0607 HD0608 HD0606 HD0606 HD0609 HD0608 dksA, - HD0603 folK, - HD0605 tbpA, - HD0601 pcnB, - HD0604 HD0602 HD0602
* Calculated from Protein Sequence

Gene ID: HD0604

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pcnB  

Definition:
poly(A) polymerase (pcnB)

Gene Start:
463909

Gene Stop:
465480

Gene Length:
1572

Molecular Weight*:
60760

pI*:
10.80

Net Charge*:
37.50

EC:
2.7.7.19  

Functional Class:
Transcription; RNA synthesis, modification, and DNA transcription  

Pathway: pathway table

Secondary Evidence:
Mohanty BK, Kushner SR.
Residual polyadenylation in poly(A) polymerase I (pcnB ) mutants of Escherichia coli does not result from the activity encoded by the f310 gene.
Mol Microbiol. 1999 Dec;34(5):1109-19.
PMID: 10594834

Liu,J.D. and Parkinson,J.S.
Genetics and sequence analysis of the pcnB locus, an Escherichia
coli gene involved in plasmid copy number control
Journal of bacteriology. 171 (3), 1254-1261 (1989)
MEDLINE: 89155419

Cao,G.J. and Sarkar,N.
Identification of the gene for an Escherichia coli poly(A)
polymerase
Proc. Natl. Acad. Sci. U.S.A. 89 (21), 10380-10384 (1992)
MEDLINE: 93066242

Masters,M., March,J.B., Oliver,I.R. and Collins,J.F.
A possible role for the pcnB gene product of Escherichia coli in
modulating RNA: RNA interactions
Mol. Gen. Genet. 220 (2), 341-344 (1990)
MEDLINE: 90220511



Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to plasmid copy number (PCN) proteins and polyA polymerase (PAP) proteins; residues 65-498 are 64% similar to PCNB_HAEIN [1172043], residues 69-492 are 51% similar to PCNB_ECOLI [2507091], and residues 84-493 are 39% similar to the sequence for polyA polymerase in Neisseria meningitidis MC58 [7226078]. The middle region (approx. residues 100-330) of this sequence has similarities to many other prokaryotic polyA polymerases.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0617
COG name: tRNA nucleotidyltransferase/poly(A) polymerase
Functional Class: J
The phylogenetic pattern of COG0617 is ----yQvCEbrHuj--oLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002646 (Poly A polymerase family) with a combined E-value of 3.6e-40.
    IPB002646A    118-137
    IPB002646B    208-223
    IPB002646C    248-274
    IPB002646D    296-309


ProDom Summary:  Protein Domain Search
Residues 120-317 are 73% similar to a (COMPLETE PROTEOME NUCLEOTIDYLTRANSFERASE) protein domain (PD003898) which is seen in PCNB_HAEIN.

Residues 318-476 are 64% similar to a (POLYMERASE POLYA COMPLETE PROTEOME) protein domain (PD036398) which is seen in Q9CMG4_PASMU.

Residues 120-307 are 59% similar to a (PROTEOME COMPLETE TRNA TRANSFERASE) protein domain (PD377189) which is seen in PCNB_ECOLI.



Paralogs:  Local Blast Search


HD0604 is paralogously related to HD1091 (4e-13).


Pfam Summary:  Pfam Search
Residues 176 to 340 (E-value = 1.2e-65) place HD0604 in the PolyA_pol family which is described as Poly A polymerase family (PF01743)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LIVIFSLFRTRWIIFNYIKSLFSRQKKAKKQPLVTPEMADMGLVTSNKAG
KWRAKPTKSKGSEALAKRNKKQSELTVAHQLHKKFTVSANHYQIYPKDFP
KNALAIVEKLDKAGYEAYLVGGCIRDLLLGHKAKDVDIATNAKPEEIQKI
FGRQCRLIGRRFRLAHIVFGREIYEVATFRADHSITASDKISKISDQGML
LRDNVYGSLSDDAERRDFTVNALYYDPKRQLIFDFFDGINDLKHAKLRLI
GNPVTRYQEDPVRMLRAVRFMAKLDMFLDKPSDAPIYELASLLKNIPAAR
LFDESLKLLQSGQGFKTYQLMRQYGLFEQLFPVLTPFFTAQNDSQVERML
NKALTATDERIRDRLHVNPAFLFAALLWYPLREKMDVLKNEGGLNNYDAM
MLAANDILAESCKAIALHRRHTAVIREIWALQFQFVKRTGKRPLQTLEHV
KFRAAFDLLVMRAEIEGGDLVELSAWWHEFQFSNDHQRVEMLKTARYLPQ
TEHKKRRRKTFRKKKTSRKRHLS$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATTGTTATTTTTTCATTATTCAGGACGAGGTGGATTATTTTTAACTA
CATTAAGTCGTTATTTTCACGACAAAAAAAAGCTAAAAAACAACCGCTTG
TAACGCCAGAAATGGCTGATATGGGTTTAGTAACTAGCAATAAAGCGGGT
AAATGGCGAGCTAAACCAACAAAATCTAAAGGCAGTGAAGCCTTAGCAAA
GCGAAATAAAAAACAATCAGAATTAACGGTTGCCCATCAGTTACATAAAA
AATTCACCGTAAGTGCGAACCATTATCAAATCTATCCGAAAGATTTCCCG
AAAAACGCCTTAGCTATTGTAGAGAAGTTAGACAAAGCCGGTTATGAGGC
TTATCTAGTGGGTGGGTGTATCCGTGATTTATTATTAGGTCATAAAGCAA
AAGATGTGGATATTGCCACTAATGCTAAACCTGAAGAAATTCAGAAAATC
TTTGGGCGACAATGTCGTTTAATTGGGCGCCGTTTTCGTTTAGCACATAT
TGTGTTTGGTCGAGAAATATATGAGGTTGCTACTTTTCGCGCTGATCACA
GTATCACTGCGAGCGATAAGATCTCTAAAATCAGTGATCAAGGAATGTTA
TTACGTGATAACGTGTATGGCTCATTAAGCGATGATGCAGAACGGCGTGA
TTTTACTGTAAATGCACTTTACTATGATCCAAAACGGCAGTTAATTTTTG
ATTTTTTCGATGGCATTAATGATTTAAAACACGCTAAGTTGCGCTTAATT
GGTAATCCGGTGACACGTTATCAAGAAGATCCGGTAAGAATGTTACGCGC
GGTGCGATTTATGGCTAAATTGGATATGTTCTTAGATAAGCCTAGTGATG
CACCTATTTATGAATTGGCGTCTTTGCTGAAAAATATTCCAGCCGCGCGT
TTATTTGATGAATCATTGAAGTTATTGCAATCAGGTCAAGGTTTTAAAAC
TTATCAATTAATGCGTCAATATGGATTGTTTGAACAGTTATTCCCAGTGT
TAACCCCCTTTTTCACCGCACAGAATGATTCACAAGTAGAGCGGATGTTG
AACAAAGCATTAACAGCAACAGATGAGAGAATTCGTGATCGTTTGCATGT
TAACCCTGCTTTTTTATTTGCTGCGTTATTATGGTATCCACTACGTGAAA
AGATGGATGTTTTAAAAAATGAAGGTGGTTTGAATAATTATGATGCAATG
ATGTTGGCGGCTAATGATATTTTGGCAGAGAGCTGTAAAGCGATTGCCCT
GCATCGTCGTCATACTGCTGTTATTCGTGAGATTTGGGCATTACAATTTC
AGTTTGTAAAACGTACCGGGAAACGTCCTCTACAGACGTTGGAACATGTT
AAATTCCGTGCAGCCTTTGATTTATTAGTGATGCGAGCAGAAATTGAGGG
TGGGGATTTAGTTGAATTATCGGCGTGGTGGCATGAGTTTCAATTTAGTA
ATGATCACCAACGGGTTGAAATGTTGAAAACCGCCCGCTATTTACCGCAA
ACTGAGCATAAAAAACGGCGTCGTAAAACATTTAGAAAGAAAAAAACGTC
ACGAAAACGCCACTTATCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy