Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR418 IGR414 IGR421 IGR413 IGR416 IGR417 IGR415 IGR412 IGR419 IGR420 HD0592 datP, - HD0598 HD0595 ruvC, - HD0593 HD0588 lemA, - HD0591 HD0596 ygcG, - HD0589 HD0600 aspS, - HD0599 HD0597 dksA, - HD0603 tbpA, - HD0601 HD0592 datP, - HD0598 HD0595 ruvC, - HD0593 HD0588 lemA, - HD0591 HD0596 ygcG, - HD0589 HD0600 aspS, - HD0599 HD0597 dksA, - HD0603 tbpA, - HD0601 datP, - HD0598 HD0595 ruvC, - HD0593 HD0588 lemA, - HD0591 HD0596 ygcG, - HD0589 HD0600 aspS, - HD0599 HD0590 HD0590 HD0592 HD0597 tbpA, - HD0601 HD0602 dksA, - HD0603 HD0602
* Calculated from Protein Sequence

Gene ID: HD0598

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
datP  

Definition:
datP pyrophosphohydrolase, ntpA

Gene Start:
458811

Gene Stop:
458347

Gene Length:
465

Molecular Weight*:
17721

pI*:
7.00

Net Charge*:
0.00

EC:
3.6.1.-  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to dATP pyrophosphohydrolase protein sequences,e.g.residues 1-151 are 57% similar to dATP pyrophosphohydrolase in Haemophilus influenzae strain Rd KW20 (1171781).

Residues 9-153 are 59% similar to dATP pyrophosphohydrolase in Escherichia coli (15802278|).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0494
COG name: NTP pyrophosphohydrolases (MutT family) including oxidative damage repair enzymes
Functional Class: L,R
The phylogenetic pattern of COG0494 is a-T-YqvCEBRHuj---linx
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** PR01404 (DATP pyrophosphohydrolase signature) with a combined E-value of 1.6e-63.
    PR01404A    9-26
    PR01404B    26-47
    PR01404C    77-96
    PR01404D    105-126
    PR01404E    132-145
***** IPB000086 (NUDIX hydrolase) with a combined E-value of 7.5e-07.
    IPB000086    39-65


ProDom Summary:  Protein Domain Search
Residues 9-68 are 71% similar to a (COMPLETE PROTEOME HYDROLASE MUTATOR MUTT/NUDIX FAMILY) protein domain (PD000653) which is seen in NUDB_ECOLI.

Residues 71-150 are 63% similar to a (PYROPHOSPHOHYDROLASE PROTEOME COMPLETE) protein domain (PD019988) which is seen in Q9CM60_PASMU.

Residues 9-68 are 71% similar to a (PROTEOME 3.6.1.- COMPLETE NTPA) protein domain (PD406490) which is seen in Q47419_ECOLI.



Paralogs:  Local Blast Search
HD0598 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 11 to 151 (E-value = 2.4e-20) place HD0598 in the NUDIX family which is described as NUDIX domain (PF00293)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LLKMLTTPYKNPNSVLIVIYAQNTKRVLMLQRKDDPSFWQSVTGSLEQQE
SALEAAKREVLEEVGIDITQQKLTIYDCQKSVKFEIFPHFRYKYAPNVTH
CCEHWFLLALPNEQTPTLTEHLTFKWLSADEAIHLTKSPNNAAAIAKYLL
NQAD$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTAAAAATGCTCACTACCCCATACAAAAACCCAAATTCTGTATTAAT
TGTTATTTATGCACAAAATACTAAGCGAGTTTTAATGCTACAACGCAAAG
ATGATCCGAGTTTTTGGCAATCAGTAACAGGTTCATTAGAACAGCAAGAA
TCTGCCTTAGAAGCAGCAAAACGGGAAGTTTTGGAAGAAGTTGGCATTGA
TATTACCCAGCAAAAACTAACGATTTATGATTGTCAAAAATCAGTAAAAT
TTGAGATTTTTCCACATTTCCGCTATAAATATGCGCCGAATGTGACACAT
TGTTGTGAACATTGGTTTTTATTAGCATTACCCAATGAACAAACACCAAC
ATTAACCGAACATTTAACGTTTAAATGGCTTTCTGCTGATGAAGCAATTC
ATCTAACGAAATCCCCCAATAATGCGGCAGCGATTGCAAAATATTTGCTT
AATCAGGCCGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy