Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR418 IGR410 IGR408 IGR409 IGR411 IGR414 IGR413 IGR416 IGR417 IGR415 IGR412 IGR419 HD0592 datP, - HD0598 yhbN, - HD0587 ptsN, - HD0585 HD0595 ruvC, - HD0593 HD0588 lemA, - HD0591 yhbG, - HD0586 HD0596 ygcG, - HD0589 yhbJ, - HD0584 HD0600 aspS, - HD0599 HD0597 HD0592 datP, - HD0598 yhbN, - HD0587 ptsN, - HD0585 HD0595 ruvC, - HD0593 HD0588 lemA, - HD0591 yhbG, - HD0586 HD0596 ygcG, - HD0589 yhbJ, - HD0584 HD0600 aspS, - HD0599 HD0597 datP, - HD0598 yhbN, - HD0587 HD0595 ruvC, - HD0593 HD0588 lemA, - HD0591 yhbG, - HD0586 HD0596 ygcG, - HD0589 yhbJ, - HD0584 HD0600 aspS, - HD0599 HD0590 HD0590 HD0592 ptsN, - HD0585 HD0597
* Calculated from Protein Sequence

Gene ID: HD0593

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ruvC  

Definition:
crossover junction endodeoxyribonuclease

Gene Start:
456830

Gene Stop:
456252

Gene Length:
579

Molecular Weight*:
20955

pI*:
10.80

Net Charge*:
9.43

EC:
3.1.22.4  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Sharples,G.J. and Lloyd,R.G.
Resolution of Holliday junctions in Escherichia coli:
identification of the ruvC gene product as a 19-kilodalton protein
J. Bacteriol. 173 (23), 7711-7715 (1991)
Medline: 92041688

Takahagi,M., Iwasaki,H., Nakata,A. and Shinagawa,H.
Molecular analysis of the Escherichia coli ruvC gene, which encodes a Holliday junction-specific endonuclease
J. Bacteriol. 173 (18), 5747-5753 (1991)
Medline: 91358366

Dunderdale,H.J., Benson,F.E., Parsons,C.A., Sharples,G.J.,
Lloyd,R.G. and West,S.C.
Formation and resolution of recombination intermediates by E. coli
RecA and RuvC proteins
Nature 354 (6354), 506-510 (1991)
Medline: 92100188

Ariyoshi,M., Vassylyev,D.G., Iwasaki,H., Nakamura,H., Shinagawa,H.
and Morikawa,K.
Atomic structure of the RuvC resolvase: a holliday
junction-specific endonuclease from E. coli
Cell 78 (6), 1063-1072 (1994)
Medline: 95007756



Comment:
From Genbank:[gi:1173332]
This enzyme resolves holliday junction intermediates in genetic recombination. It cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in homologous arms and leaves a 5' terminal phosphate and a 3' terminal hydroxyl group.




Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to crossover junction endodeoxyribonuclease protein sequences,e.g.residues 1-191 are 81% similar to crossover junction endodeoxyribonuclease in Haemophilus influenzae strain Rd KW20 (1173332|).

Residues 1-158 are 79% similar to crossover junction endodeoxyribonuclease in Escherichia coli (134125|).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0817
COG name: Holliday junction endodeoxyribonuclease RuvC
Functional Class: L
The phylogenetic pattern of COG0817 is ------vce-rhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002176 (Crossover junction endodeoxyribonuclease RuvC) with a combined E-value of 4.5e-70.
    IPB002176A    4-15
    IPB002176B    55-100
    IPB002176C    101-128
    IPB002176D    129-150


ProDom Summary:  Protein Domain Search
Residues 4-155 are 77% similar to a (JUNCTION HOLLIDAY NUCLEASE DNA) protein domain (PD008333) which is seen in RUVC_HAEIN.



Paralogs:  Local Blast Search


HD0593 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 150 (E-value = 1e-92) place HD0593 in the RuvC family which is described as Crossover junction endodeoxyribonuclease RuvC (PF02075)

PDB Hit:
pdb|1HJR|A Chain A, Holliday Junction Resolvase (E.C.3.1.22.4) ... 214 5e-057

Gene Protein Sequence:
MPIILGIDPGSRITGYGIIRQQGRQLEYLGSGAIRINASDLPSRLKHIYA
GVTEIITQFQPDMFAIEQVFMAKNADSALKLGQARGTAIVAAVNHDLPVF
EYAARLVKQTVTGIGSADKLQVQDMVTRMLQLSAKPQVDAADALAIAITH
AHSIQHSLIVAKQNNPSITTHKEQILALMKTRYSRGRFRLKG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGATTATTTTAGGAATTGATCCCGGCTCACGCATAACGGGCTACGG
TATTATCCGCCAACAAGGTCGTCAATTAGAATATTTAGGCAGTGGTGCTA
TTCGCATCAATGCTAGTGATCTACCTAGTCGTTTAAAACATATTTATGCT
GGCGTAACCGAAATTATTACGCAATTTCAGCCTGATATGTTTGCTATTGA
ACAAGTTTTTATGGCAAAAAATGCGGATTCTGCATTAAAACTAGGGCAAG
CTCGAGGCACAGCAATTGTAGCAGCGGTTAATCATGACTTACCCGTTTTC
GAATATGCTGCAAGATTAGTTAAACAAACCGTGACCGGCATAGGCTCAGC
AGATAAACTGCAAGTGCAAGATATGGTAACACGAATGCTACAATTATCCG
CTAAACCTCAAGTTGATGCGGCTGATGCACTAGCAATTGCCATCACACAC
GCCCATTCTATCCAACATTCATTAATTGTTGCTAAACAAAACAACCCTTC
CATTACAACACACAAAGAACAAATTCTTGCCTTAATGAAAACACGCTATA
GCCGAGGAAGATTTAGATTAAAAGGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy