Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR418 IGR410 IGR408 IGR409 IGR411 IGR414 IGR407 IGR413 IGR416 IGR417 IGR415 IGR412 HD0592 datP, - HD0598 yhbN, - HD0587 ptsN, - HD0585 HD0595 ruvC, - HD0593 HD0588 lemA, - HD0591 yhbG, - HD0586 HD0596 ygcG, - HD0589 yhbJ, - HD0584 visC, - HD0582 aspS, - HD0599 HD0597 HD0592 datP, - HD0598 yhbN, - HD0587 ptsN, - HD0585 HD0595 ruvC, - HD0593 HD0588 lemA, - HD0591 yhbG, - HD0586 HD0596 ygcG, - HD0589 yhbJ, - HD0584 visC, - HD0582 aspS, - HD0599 HD0597 datP, - HD0598 yhbN, - HD0587 ptsN, - HD0585 HD0595 ruvC, - HD0593 HD0588 lemA, - HD0591 yhbG, - HD0586 HD0596 ygcG, - HD0589 yhbJ, - HD0584 visC, - HD0582 aspS, - HD0599 HD0590 HD0590 HD0592 HD0597
* Calculated from Protein Sequence

Gene ID: HD0590

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
455416

Gene Stop:
454967

Gene Length:
450

Molecular Weight*:
16982

pI*:
8.20

Net Charge*:
3.06

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Very few significant hits in gapped BLAST to hypothetical protein sequences, e.g.residues 59-147 are 35% similar to hypothetical protein in Mesorhizobium loti (13473504|). Residues 7-148 are 51% similar to >15602649 unknown [Pasteurella multocida].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 37-148 are 50% similar to a (PROTEOME COMPLETE PM0784) protein domain (PD415064) which is seen in Q9CMN3_PASMU.



Paralogs:  Local Blast Search
HD0590 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 131 (E-value = 7.2e-23) place HD0590 in the DUF477 family which is described as Domain of unknown function (DUF477) (PF04536)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQRIPFLTNKLPIDIHKIEQAIAELEQQTTAELRVVVERKAKGKGNAIMR
ANQLFDELNMRATSARNGVLIYLSFKPHHLAIVGDHAIHEKVGQVFWQSI
YDQMKLACQQTHYTQAICHGIQQVSIQLAKHFPHQPGDINELDNEVVIK$


Gene Nucleotide Sequence:  Sequence Viewer
ATGCAACGCATTCCTTTCCTGACAAATAAACTGCCCATAGATATACACAA
AATTGAACAAGCCATTGCAGAGCTAGAACAACAAACAACGGCTGAATTAC
GTGTTGTTGTAGAACGTAAAGCAAAAGGCAAAGGAAATGCAATAATGCGC
GCTAATCAATTATTTGATGAATTAAATATGCGGGCTACCTCCGCACGAAA
TGGTGTACTTATTTACCTTTCTTTTAAGCCTCATCATTTGGCAATTGTGG
GCGATCACGCTATTCACGAAAAAGTCGGACAGGTTTTTTGGCAATCGATT
TATGATCAAATGAAATTAGCTTGTCAGCAGACTCATTATACACAAGCGAT
TTGTCATGGCATTCAACAAGTTAGCATTCAACTTGCTAAACATTTTCCTC
ATCAACCTGGTGATATTAATGAACTCGACAATGAGGTAGTAATTAAATGA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy