Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR410 IGR403 IGR408 IGR409 IGR411 IGR414 IGR407 IGR404 IGR405 IGR413 IGR415 IGR406 IGR412 HD0592 hlpB,p27, - HD0581 yhbN, - HD0587 ptsN, - HD0585 ruvC, - HD0593 HD0588 lemA, - HD0591 hlp,p27, - HD0580 yhbG, - HD0586 ygcG, - HD0589 yhbJ, - HD0584 visC, - HD0582 ubiH, - HD0579 selD, - HD0577 HD0592 hlpB,p27, - HD0581 yhbN, - HD0587 ptsN, - HD0585 ruvC, - HD0593 HD0588 lemA, - HD0591 hlp,p27, - HD0580 yhbG, - HD0586 ygcG, - HD0589 yhbJ, - HD0584 visC, - HD0582 ubiH, - HD0579 selD, - HD0577 hlpB,p27, - HD0581 yhbN, - HD0587 ptsN, - HD0585 ruvC, - HD0593 HD0588 lemA, - HD0591 hlp,p27, - HD0580 yhbG, - HD0586 ygcG, - HD0589 yhbJ, - HD0584 visC, - HD0582 HD0590 HD0590 HD0592 ubiH, - HD0579 ubiH, - HD0578 selD, - HD0577 ubiH, - HD0578
* Calculated from Protein Sequence

Gene ID: HD0585

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ptsN  

Definition:
nitrogen regulatory IIA homolog, ptsN

Gene Start:
452147

Gene Stop:
451623

Gene Length:
525

Molecular Weight*:
19263

pI*:
4.60

Net Charge*:
-8.70

EC:
2.7.1.69  

Functional Class:
Central intermediary metabolism; Nitrogen metabolism  
Regulatory functions  

Pathway: pathway table
Aminosugars metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism

Secondary Evidence:
Powell,B.S., Court,D.L., Inada,T., Nakamura,Y., Michotey,V.,
Cui,X., Reizer,A., Saier,M.H. Jr. and Reizer,J.
Novel proteins of the phosphotransferase system encoded within the
rpoN operon of Escherichia coli. Enzyme IIANtr affects growth on
organic nitrogen and the conditional lethality of an erats mutant
J. Biol. Chem. 270 (9), 4822-4839 (1995)
Medline: 95181483

Bordo,D., van Monfort,R.L., Pijning,T., Kalk,K.H., Reizer,J.,
Saier,M.H. Jr. and Dijkstra,B.W.
The three-dimensional structure of the nitrogen regulatory protein
IIANtr from Escherichia coli
J. Mol. Biol. 279 (1), 245-255 (1998)
Medline: 98300343


Comment:
This protein seems to have a role in linking carbon and nitrogen assimilation.

For other PTS related genes, see HD1859 (ptsII), HD0768 (ptsA), HD0227, HD0766 (ptnD), HD0767 (ptnC).

Blast Summary:  PSI-Blast Search
This sequence correponds to the previously reported 6969428 in Genbank.

Significant hits in gapped BLAST to nitrogen regulatory IIA protein sequences,e.g.residues 2-174 are 36% similar to nitrogen regulatory IIA protein in Escherichia coli (401564|).



COGS Summary:  COGS Search
BeTs to 6 clades of COG1762
COG name: Phosphotransferase system mannitol/fructose-specific IIA domain (Ntr-type)
Functional Class:  G,T
The phylogenetic pattern of COG1762 is --------EB-H--gPOLIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002178 (phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2) with a combined E-value of 5e-08.
    IPB002178    61-78


ProDom Summary:  Protein Domain Search
Residues 58-159 are 43% similar to a (IIA PTS DNA-BINDING COMPLETE) protein domain (PD171762) which is seen in Q9CP84_PASMU.

Residues 4-159 are 45% similar to a (COMPONENT SYSTEM PHOSPHOTRANSFERASE IIA) protein domain (PD001689) which is seen in PTSN_HAEIN.

Residues 1-54 are identical to a (PTSN PROTEOME COMPLETE) protein domain (PD258630) which is seen in Q9L7V4_HAEDU.

Residues 55-174 are identical to a (PTSN) protein domain (PD396223) which is seen in Q9L7V4_HAEDU.



Paralogs:  Local Blast Search

HD0585 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 166 (E-value = 1.3e-06) place HD0585 in the PTS_EIIA_2 family which is described as Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 (PF00359)

PDB Hit:
pdb|1A6J|B Chain B, Nitrogen Regulatory Bacterial Protein Iia-N... 107 1e-024

Gene Protein Sequence:
MMKLTEFLTKENIRQGVIVSSKKRALELIGKIVADSLNNTPDGSTAENIC
AIECFSQLFKREKLGSTSINGGIALPHAKLPASTDSMLTFTTPISVFLQL
ENGIDYEASDNKEVDLIYAIMLPSDCCDKYKDDLPALAEKLSDKSLAKQL
RAATSSEEIWQYLEYADHQIEPNE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAAATTAACTGAGTTTCTAACCAAAGAAAATATCCGTCAAGGCGT
AATTGTTTCAAGCAAAAAAAGAGCCTTAGAACTTATTGGAAAAATAGTGG
CGGATTCATTAAATAATACGCCGGATGGTTCAACAGCCGAAAATATTTGT
GCAATCGAATGTTTTAGCCAGCTGTTTAAACGAGAAAAATTAGGCTCAAC
CAGTATTAATGGCGGCATTGCATTACCACACGCTAAATTACCCGCTTCAA
CCGATTCAATGTTAACATTCACAACACCTATTAGCGTCTTTCTACAACTT
GAAAACGGTATTGACTATGAAGCAAGCGATAATAAAGAAGTTGATCTGAT
TTACGCCATTATGTTGCCATCAGATTGTTGTGATAAATACAAAGATGACC
TGCCAGCTCTCGCTGAAAAATTGAGTGACAAATCACTGGCAAAACAATTG
CGTGCAGCAACATCTAGCGAAGAAATTTGGCAATACTTGGAATATGCAGA
TCATCAAATTGAACCAAATGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy