Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR403 IGR408 IGR409 IGR407 IGR404 IGR405 IGR401 IGR406 IGR402 hlpB,p27, - HD0581 ptsN, - HD0585 hlp,p27, - HD0580 yhbG, - HD0586 yhbJ, - HD0584 prfB, - HD0575 visC, - HD0582 potC, - HD0574 ubiH, - HD0579 selD, - HD0577 potA,potG, - HD0572 hlpB,p27, - HD0581 ptsN, - HD0585 hlp,p27, - HD0580 yhbG, - HD0586 yhbJ, - HD0584 prfB, - HD0575 visC, - HD0582 potC, - HD0574 ubiH, - HD0579 selD, - HD0577 potA,potG, - HD0572 hlpB,p27, - HD0581 ptsN, - HD0585 hlp,p27, - HD0580 yhbG, - HD0586 yhbJ, - HD0584 prfB, - HD0575 visC, - HD0582 potC, - HD0574 ubiH, - HD0579 selD, - HD0577 ubiH, - HD0578 potB, - HD0573 ubiH, - HD0578 potB, - HD0573 potA,potG, - HD0572
* Calculated from Protein Sequence

Gene ID: HD0579

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ubiH  

Definition:
2-octaprenyl-6-methoxyphenol hydroxylase

Gene Start:
447340

Gene Stop:
448140

Gene Length:
801

Molecular Weight*:
29616

pI*:
7.20

Net Charge*:
0.88

EC:
1.14.13.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Alkaloid biosynthesis I
Androgen and estrogen metabolism
Bile acid biosynthesis
Flavonoids, stilbene and lignin biosynthesis
gamma-Hexachlorocyclohexane degradation
Histidine metabolism
Methane metabolism
Phenylalanine metabolism
Sterol biosynthesis
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Nakahigashi,K., Miyamoto,K., Nishimura,K. and Inokuchi,H.
Isolation and characterization of a light-sensitive mutant of
Escherichia coli K-12 with a mutation in a gene that is required
for the biosynthesis of ubiquinone
J. Bacteriol. 174 (22), 7352-7359 (1992)
Medline: 93054351

Kwon O, Kotsakis A, Meganathan R.
Ubiquinone (coenzyme Q) biosynthesis in Escherichia coli: identification of the ubiF gene.
FEMS Microbiol Lett. 2000 May 15;186(2):157-61.
PMID: 10802164


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to 2-octaprenyl-6-methozyphenol hydroxylase protein sequences,e.g. residues 8-265 are 41% similar to 2-octaprenyl-6-methozyphenol hydroxylase in Escherichia coli (136661|). Residues 4-265 are 46% similar to 23468099 hypothetical protein [Haemophilus somnus 129PT].

COGS Summary:  COGS Search
BeTs to 6 clades of COG0654
COG name: 2-Octaprenyl-6-metoxyphenol hydroxylase and related FAD-dependent oxidoreductases
Functional Class: H,C
The phylogenetic pattern of COG0654 is ----Y--cEBR---------x
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB000689 (UbiH/COQ6 monooxygenase family) with a combined E-value of 6.1e-43.
    IPB000689B    33-67
    IPB000689C    78-102
    IPB000689D    158-208
***** PR00420 (Aromatic-ring hydroxylase (flavoprotein monooxygenase) signature) with a combined E-value of 9.7e-08.
    PR00420B    31-46
    PR00420C    154-169
    PR00420D    169-185


ProDom Summary:  Protein Domain Search
Residues 153-213 are 57% similar to a (MONOOXYGENASE OXIDOREDUCTASE HYDROXYLASE FAD) protein domain (PD000900) which is seen in Q9KP98_VIBCH.

Residues 58-149 are 55% similar to a (FLAVOPROTEIN FAD OXIDOREDUCTASE) protein domain (PD009774) which is seen in Q9CKA0_PASMU.



Paralogs:  Local Blast Search
HD0579 is paralogously related to HD0582 (2e-30) and HD1874 (3e-26).


Pfam Summary:  Pfam Search
Residues 31 to 224 (E-value = 6.9e-12) place HD0579 in the Monooxygenase family which is described as Monooxygenase (PF01360)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MCSYFVTNEVIEVNRSAQECLLTLQDGQQLHSQLMIAADGTQSKLAHQCG
VKTELCHDYQQSAIIANITISQPHHFQAFERFTAEGPIALLPMSEQQMSL
VWCVKQAESLMASSDQVFLTRLQQQVGWKLGRFTQVSKRFAYPLTSQKAS
AHVHHRLAIVGNAAQLLHPVAGQGFNLALRDLYTLATLLGDAFGQGKDLG
EFSLLQYFMQARQADQQHIMQLTNGLVSLFTDQTLAVQAVRNLALFAIEH
TSLGRSWIAHQALGWH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGCAGTTATTTTGTCACAAATGAAGTGATTGAGGTTAACCGTTCAGC
ACAGGAATGTTTATTAACGTTACAAGATGGACAACAATTACACAGCCAGT
TAATGATTGCTGCAGATGGAACGCAATCGAAATTGGCCCATCAATGTGGC
GTGAAGACAGAGTTATGCCATGATTATCAACAAAGTGCCATTATTGCAAA
TATTACAATCAGTCAACCACATCATTTTCAAGCTTTTGAGCGTTTTACGG
CAGAAGGTCCCATTGCATTATTACCTATGAGTGAACAGCAAATGTCGCTT
GTATGGTGTGTTAAACAAGCAGAATCTTTAATGGCGAGTTCCGATCAAGT
CTTTTTAACGAGATTACAACAACAAGTTGGCTGGAAATTAGGGCGCTTTA
CTCAAGTGAGTAAACGTTTTGCTTATCCGCTGACTTCTCAAAAAGCAAGC
GCGCATGTCCATCATCGATTGGCAATTGTTGGAAATGCGGCACAATTATT
GCATCCAGTGGCAGGACAAGGATTTAATTTAGCTTTACGTGATTTATATA
CGCTAGCAACATTACTAGGAGATGCTTTTGGGCAAGGTAAAGATCTTGGC
GAATTTAGTCTGTTGCAATATTTTATGCAGGCTAGACAAGCAGATCAGCA
ACATATTATGCAATTGACTAATGGATTGGTTTCGTTATTTACTGATCAAA
CTTTGGCAGTACAAGCGGTAAGAAATTTAGCATTATTTGCCATTGAACAT
ACCTCTTTAGGGCGGAGTTGGATTGCTCACCAAGCCTTAGGGTGGCATTG
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy