Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR403 IGR408 IGR409 IGR407 IGR404 IGR405 IGR401 IGR406 IGR402 hlpB,p27, - HD0581 ptsN, - HD0585 hlp,p27, - HD0580 yhbJ, - HD0584 prfB, - HD0575 visC, - HD0582 potC, - HD0574 ubiH, - HD0579 selD, - HD0577 potA,potG, - HD0572 hlpB,p27, - HD0581 ptsN, - HD0585 hlp,p27, - HD0580 yhbJ, - HD0584 prfB, - HD0575 visC, - HD0582 potC, - HD0574 ubiH, - HD0579 selD, - HD0577 potA,potG, - HD0572 hlpB,p27, - HD0581 ptsN, - HD0585 hlp,p27, - HD0580 yhbJ, - HD0584 prfB, - HD0575 visC, - HD0582 potC, - HD0574 ubiH, - HD0579 selD, - HD0577 potA,potG, - HD0572 ubiH, - HD0578 potB, - HD0573 ubiH, - HD0578 potB, - HD0573
* Calculated from Protein Sequence

Gene ID: HD0578

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ubiH  

Definition:
2-octaprenyl-6-methoxyphenol 4-monoxygenase

Gene Start:
446940

Gene Stop:
447365

Gene Length:
426

Molecular Weight*:
15321

pI*:
8.00

Net Charge*:
1.81

EC:
1.14.13.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Alkaloid biosynthesis I
Androgen and estrogen metabolism
Bile acid biosynthesis
Flavonoids, stilbene and lignin biosynthesis
gamma-Hexachlorocyclohexane degradation
Histidine metabolism
Methane metabolism
Phenylalanine metabolism
Sterol biosynthesis
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Nakahigashi,K., Miyamoto,K., Nishimura,K. and Inokuchi,H.
Isolation and characterization of a light-sensitive mutant of
Escherichia coli K-12 with a mutation in a gene that is required
for the biosynthesis of ubiquinone
J. Bacteriol. 174 (22), 7352-7359 (1992)
Medline: 93054351

Kwon O, Kotsakis A, Meganathan R.
Ubiquinone (coenzyme Q) biosynthesis in Escherichia coli: identification of the ubiF gene.
FEMS Microbiol Lett. 2000 May 15;186(2):157-61.
PMID: 10802164


Comment:


Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to probable 2-octaprenyl-6-methoxyphenol 4-monoxygenase protein sequences, e.g.residues 7-139 are 39% similar to 2-octaprenyl-6-methoxyphenol 4-monoxygenase in Escherichia coli (136661|). Residues 2-135 are 47% similar to >15603590 unknown [Pasteurella multocida].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 5-135 are 48% similar to a (PROTEOME COMPLETE PM1725 UBIH) protein domain (PD337554) which is seen in Q9CKA0_PASMU.



Paralogs:  Local Blast Search
HD0578 is paralogously related to HD0582 (6e-04) and HD1874 (0.001).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAEKFDVVIVGSAITGSVLALALSSFSQHNMRIAVIEKMPTNYTQQGGFD
TRSIALAEGSLQKFSQIQPRIGENLAVKIRQMATPIKQVHVSDAGHFGKV
SLMADELGLSQLGCVIELARLGDYLTECLSKQTNVQLFCHK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGAAAAGTTTGATGTTGTTATCGTCGGAAGCGCTATTACAGGTTC
AGTGCTAGCATTAGCCTTAAGTAGTTTTAGCCAACATAATATGCGGATTG
CCGTGATTGAGAAAATGCCAACTAATTATACCCAGCAAGGTGGTTTCGAT
ACCCGTAGCATTGCATTGGCTGAGGGGAGTTTGCAGAAATTTAGCCAGAT
TCAACCGCGTATAGGTGAAAATTTAGCGGTTAAAATTAGGCAAATGGCAA
CGCCAATTAAGCAGGTGCATGTTTCAGATGCGGGGCATTTTGGCAAAGTA
AGTTTGATGGCGGATGAATTAGGTCTTAGCCAGCTAGGCTGTGTTATTGA
GCTGGCGAGACTAGGCGATTATTTAACTGAATGTTTAAGCAAACAAACGA
ATGTGCAGTTATTTTGTCACAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy