Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR403 IGR407 IGR404 IGR405 IGR401 IGR406 IGR402 IGR400 hlpB,p27, - HD0581 hlp,p27, - HD0580 yhbJ, - HD0584 prfB, - HD0575 visC, - HD0582 rep, - HD0571 potC, - HD0574 ubiH, - HD0579 selD, - HD0577 potA,potG, - HD0572 hlpB,p27, - HD0581 hlp,p27, - HD0580 yhbJ, - HD0584 prfB, - HD0575 visC, - HD0582 rep, - HD0571 potC, - HD0574 ubiH, - HD0579 selD, - HD0577 potA,potG, - HD0572 hlpB,p27, - HD0581 hlp,p27, - HD0580 yhbJ, - HD0584 prfB, - HD0575 visC, - HD0582 rep, - HD0571 potC, - HD0574 ubiH, - HD0579 selD, - HD0577 potA,potG, - HD0572 ubiH, - HD0578 potB, - HD0573 ubiH, - HD0578 potB, - HD0573
* Calculated from Protein Sequence

Gene ID: HD0577

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
selD  

Definition:
selenophosphate synthase

Gene Start:
445958

Gene Stop:
446929

Gene Length:
972

Molecular Weight*:
34427

pI*:
4.80

Net Charge*:
-12.30

EC:
2.7.9.3  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Selenoamino acid metabolism

Secondary Evidence:
Leinfelder,W., Forchhammer,K., Veprek,B., Zehelein,E. and Bock,A.
In vitro synthesis of selenocysteinyl-tRNA(UCA) from
seryl-tRNA(UCA): involvement and characterization of the selD gene
product
Proc. Natl. Acad. Sci. U.S.A. 87 (2), 543-547 (1990)
Medline: 90138866

Kim,I.Y., Veres,Z. and Stadtman,T.C.
Escherichia coli mutant SELD enzymes. The cysteine 17 residue is
essential for selenophosphate formation from ATP and selenide
J. Biol. Chem. 267 (27), 19650-19654 (1992)
Medline: 92406923

Kim,I.Y., Veres,Z. and Stadtman,T.C.
Biochemical analysis of Escherichia coli selenophosphate synthetase mutants. Lysine 20 is essential for catalytic activity and cysteine 17/19 for 8-azido-ATP derivatization
J. Biol. Chem. 268 (36), 27020-27025 (1993)
Medline: 94086510




Comment:
All three genes, selA , selB and selD are present to facilitate the insertion of selenocysteine in the peptide chain.

From Genbank:[gi:1075295]
This protein synthesizes selenophosphate from selenide and ATP.

For other sel genes, see HD1933 (selB) and HD1994 (selA).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to selenophosphate synthetase protein; e.g. residues 1-322 are 65% similar to selenophosphate synthase in Haemophilus influenzae strain Rd KW20 (1075295|).

Residues 1-322 are 60% similar to selenophosphate synthase in Escherichia coli (134423|).

COGS Summary:  COGS Search
BeTs to 3 clades of COG0709
COG name: Selenophosphate synthase
Functional Class: E
The phylogenetic pattern of COG0709 is -m---q--e--h---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 116-189 are 67% similar to a (SELENOPHOSPHATE SYNTHETASE SELENIUM) protein domain (PD390097) which is seen in Q9CMM8_PASMU.

Residues 18-115 are 47% similar to a (SELENIUM SELENOPHOSPHATE SYNTHETASE) protein domain (PD011247) which is seen in Q9L4E1_EUBAC.

Residues 26-115 are 86% similar to a (KINASE COMPLETE PROTEOME HYDROGENASE THIAMINE) protein domain (PD344351) which is seen in Q9CMM8_PASMU.

Residues 200-293 are 61% similar to a (SELENOPHOSPHATE SYNTHETASE SELENIUM) protein domain (PD015938) which is seen in Q9CMM8_PASMU.



Paralogs:  Local Blast Search
HD0577 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 136 (E-value = 1.2e-16) place HD0577 in the AIRS family which is described as AIR synthase related protein, N-terminal domain (PF00586)
Residues 145 to 321 (E-value = 2.5e-14) place HD0577 in the AIRS_C family which is described as AIR synthase related protein, C-terminal domain (PF02769)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VLGTILQSELDKFVDPKLLVGNETADDAAVYDIGNGLAIISTTDFFMPIV
DDPFDFGRIAATNALSDIFAMGGKPLMAIAILGFPIDKLPAEVAQKIIEG
GRFACQQAGIVLAGGHSIHSMEPIFGLAVTGMAAIEHIKRNASATAGCEL
FLTKPLGIGILTTAEKRGLLTLPHQHLVRDLMCQLNTIGTLLAPLPEMTA
MTDITGFGLLGHLSEICQASNVRAEINSHAVKVIDGVEEYVEQGMIPGGT
QRNFESYANLVSPLSDRQKAILCDQQTSGGLLIAVEPQAVEKIQQIAQQI
GSMLFHIGKLFDRAPDKALIEVN$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTAGGGACTATTTTACAAAGTGAACTAGACAAATTTGTTGATCCTAA
ATTATTAGTGGGAAATGAAACAGCAGATGATGCAGCGGTGTATGATATTG
GCAATGGTTTAGCTATTATTAGCACTACTGACTTTTTTATGCCGATTGTT
GATGATCCTTTTGATTTTGGCCGTATTGCGGCAACAAATGCATTGAGTGA
TATTTTTGCGATGGGGGGCAAACCGCTGATGGCAATTGCTATTCTAGGTT
TTCCGATTGATAAATTACCCGCAGAAGTCGCACAAAAAATTATTGAGGGT
GGGCGTTTTGCTTGTCAGCAAGCTGGCATTGTGCTTGCCGGTGGGCATTC
TATTCATTCGATGGAGCCGATTTTTGGTTTAGCCGTGACCGGTATGGCGG
CAATTGAACATATCAAACGGAATGCTTCAGCCACGGCAGGATGTGAGCTA
TTTTTAACTAAACCGCTTGGTATTGGAATTTTAACCACTGCCGAAAAACG
TGGATTGTTAACATTGCCACACCAACACCTTGTACGTGATTTAATGTGTC
AGCTCAATACTATAGGTACTTTATTAGCACCATTACCGGAAATGACCGCT
ATGACGGATATAACAGGCTTTGGCTTGTTGGGGCATTTAAGTGAAATATG
CCAAGCTTCCAATGTACGTGCTGAAATTAATAGTCACGCAGTGAAAGTAA
TCGATGGTGTTGAAGAATACGTGGAGCAAGGTATGATCCCCGGTGGTACT
CAACGAAATTTTGAGAGCTATGCGAATTTAGTTTCGCCATTGAGCGACAG
GCAAAAAGCAATTTTATGCGATCAACAAACATCTGGCGGGTTACTTATTG
CGGTTGAGCCACAAGCGGTCGAAAAAATACAACAAATTGCCCAACAAATA
GGGAGTATGCTTTTTCACATTGGTAAATTATTTGATCGTGCGCCAGATAA
AGCATTAATTGAGGTGAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy