Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR398 IGR399 IGR396 IGR400 IGR397 argE, - HD0566 potE, - HD0568 rep, - HD0571 clpB, - HD0565 HD0570 potA,potG, - HD0572 metX, - HD0569 argE, - HD0566 potE, - HD0568 rep, - HD0571 clpB, - HD0565 HD0570 potA,potG, - HD0572 metX, - HD0569 argE, - HD0566 potE, - HD0568 rep, - HD0571 clpB, - HD0565 HD0567 HD0567 HD0570 potA,potG, - HD0572 metX, - HD0569 potB, - HD0573 potB, - HD0573
* Calculated from Protein Sequence

Gene ID: HD0569

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
metX  

Definition:
S-adenosylmethionine synthase, metX

Gene Start:
437412

Gene Stop:
438572

Gene Length:
1161

Molecular Weight*:
42312

pI*:
5.70

Net Charge*:
-6.24

EC:
2.5.1.6  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Methionine metabolism
Selenoamino acid metabolism

Secondary Evidence:
Takusagawa,F., Kamitori,S., Misaki,S. and Markham,G.D.
Crystal structure of S-adenosylmethionine synthetase
The Journal of biological chemistry. 271 (1), 136-147 (1996)
Medline: 96132894

Satischandran,C., Taylor,J.C. and Markham,G.D.
Isozymes of S-adenosylmethionine synthetase are encoded by tandemly duplicated genes in Escherichia coli
Molecular microbiology. 9 (4), 835-846 (1993)
Medline: 94049123

Moore,R.C. and Boyle,S.M.
Nucleotide sequence and analysis of the speA gene encoding
biosynthetic arginine decarboxylase in Escherichia coli
Journal of bacteriology. 172 (8), 4631-4640 (1990)
Medline: 90330576

Markham,G.D., DeParasis,J. and Gatmaitan,J.
The sequence of metK, the structural gene for S-adenosylmethionine
synthetase in Escherichia coli
The Journal of biological chemistry. 259 (23), 14505-14507 (1984)
Medline: 85054924



Comment:
This protein catalyzes the formation of S-adenosylmethionine from methionine and ATP.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to S-adenosylmethionine synthase protein sequences,e.g. residues 35-414 are 87% similar to S-adenosylmethionine synthetase in Haemophilus influenzae strain Rd KW20 (1170942|).

Residues 35-412 are 82% similar to S-adenosylmethionine synthetase in Escherichia coli (1708999|).


COGS Summary:  COGS Search
BeTs to 11 clades of COG0192
COG name: S-adenosylmethionine synthetase
Functional Class: H
The phylogenetic pattern of COG0192 is ----Yqvcebrhujgpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002133 (S-adenosylmethionine synthetase) with a combined E-value of 9.6e-212.
    IPB002133A    9-53
    IPB002133B    81-113
    IPB002133C    118-148
    IPB002133D    167-218
    IPB002133E    244-280
    IPB002133F    281-318
    IPB002133G    319-368


ProDom Summary:  Protein Domain Search
Residues 10-374 are 89% similar to a (SYNTHETASE S-ADENOSYLMETHIONINE TRANSFERASE) protein domain (PD001322) which is seen in METK_HAEIN.



Paralogs:  Local Blast Search
HD0569 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 107 (E-value = 1.1e-60) place HD0569 in the S-AdoMet_synt_N family which is described as S-adenosylmethionine synthetase, N-terminal domain (PF00438)
Residues 118 to 236 (E-value = 9e-80) place HD0569 in the S-AdoMet_synt_M family which is described as S-adenosylmethionine synthetase, central domain (PF02772)
Residues 238 to 375 (E-value = 1.7e-90) place HD0569 in the S-AdoMet_synt_C family which is described as S-adenosylmethionine synthetase, C-terminal domain (PF02773)

PDB Hit:
pdb|1FUG|A Chain A, S-Adenosylmethionine Synthetase >gi|1827908... 647 0.0
pdb|1XRB| S-Adenosylmethionine Synthetase (Mat, Atp: L-Methi... 628 0.0
pdb|1QM4|A Chain A, Methionine Adenosyltransferase Complexed Wi... 417 1e-117

Gene Protein Sequence:
MRLNSMAINLFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETY
VKTGMALVGGEITTSAWVDIENLTRQVIYDIGYSHSDMGFDAHSCAVLNA
IGKQSPDINQGVDREDPLAQGAGDQGIMFGYATNETDVLMPAPITYAHRL
MQRQAEVRKSGKLAWLRPDAKSQLTFAYENNQIIGIDAVVLSTQHAEEVK
QKELIEGVMEEIIKPTLPSKWLNQHTKYFINPTGRFVIGGPMGDCGLTGR
KIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKSIVAAGLADRC
EIQLSYAIGVADPTSIMVETFGTGKVSNDTLVKLIYQNFDLRPYGLIKML
DLIQPIYRETAAYGHFGREQFPWERTDKAEALRLAL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGGTTAAATTCGATGGCAATTAATTTATTTACGTCTGAATCAGTTTC
AGAAGGGCATCCAGACAAAATCGCGGATCAAATTTCTGATGCTGTGTTAG
ATGAAATCTTAAAACAAGATCCCAAAGCACGTGTAGCGTGTGAAACCTAT
GTCAAAACAGGTATGGCATTAGTAGGGGGGGAAATTACCACTTCTGCTTG
GGTCGATATTGAAAATCTTACTCGCCAAGTCATTTATGATATCGGTTATA
GCCATTCTGATATGGGCTTTGATGCTCATTCTTGTGCAGTATTAAATGCA
ATAGGTAAACAATCGCCAGATATTAATCAAGGCGTCGATCGTGAAGATCC
ATTAGCACAAGGTGCCGGCGACCAAGGCATTATGTTTGGTTATGCTACTA
ATGAAACAGACGTTTTGATGCCTGCTCCGATAACGTATGCGCACCGTTTA
ATGCAACGTCAAGCTGAAGTGCGTAAATCAGGAAAATTAGCTTGGCTGCG
TCCAGATGCGAAAAGTCAGTTAACTTTTGCTTATGAAAATAACCAAATTA
TTGGTATTGATGCGGTAGTACTTTCTACACAACACGCTGAAGAAGTTAAG
CAAAAAGAGTTAATTGAAGGGGTGATGGAAGAAATCATTAAGCCGACTTT
ACCAAGTAAGTGGCTAAATCAGCATACCAAGTATTTTATTAATCCAACCG
GTCGTTTTGTTATCGGTGGACCAATGGGCGATTGTGGTTTAACTGGCCGT
AAAATTATTGTAGATACTTATGGCGGTGCGGCACGGCACGGTGGCGGAGC
ATTTTCGGGTAAAGATCCTTCAAAAGTTGACCGCTCAGCAGCGTATGCAG
CGCGTTATGTCGCAAAAAGTATTGTGGCAGCGGGGCTCGCAGATCGCTGT
GAAATCCAACTTTCTTATGCGATTGGCGTGGCAGATCCAACTTCAATTAT
GGTTGAAACCTTTGGAACAGGTAAAGTATCGAACGATACGTTAGTTAAAT
TAATCTATCAAAACTTTGACTTACGCCCATATGGCTTAATCAAAATGTTA
GATTTAATTCAACCTATTTATCGTGAAACTGCTGCTTATGGTCATTTTGG
GCGTGAGCAATTCCCTTGGGAAAGAACGGATAAAGCAGAAGCATTACGTC
TAGCTTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy