Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR398 IGR395 IGR399 IGR394 IGR396 IGR397 argE, - HD0566 potE, - HD0568 rep, - HD0571 clpB, - HD0565 HD0563 HD0570 metX, - HD0569 aspA, - HD0564 argE, - HD0566 potE, - HD0568 rep, - HD0571 clpB, - HD0565 HD0563 HD0570 metX, - HD0569 aspA, - HD0564 argE, - HD0566 potE, - HD0568 rep, - HD0571 clpB, - HD0565 HD0567 HD0567 HD0563 HD0570 metX, - HD0569 aspA, - HD0564
* Calculated from Protein Sequence

Gene ID: HD0566

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
argE  

Definition:
acetylornithine deacetylase

Gene Start:
435678

Gene Stop:
434656

Gene Length:
1023

Molecular Weight*:
37513

pI*:
6.50

Net Charge*:
-3.49

EC:
3.5.1.16  3.5.1.18  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Lysine biosynthesis
Urea cycle and metabolism of amino groups

Primary Evidence:
NULL

Secondary Evidence:
Meinnel,T., Schmitt,E., Mechulam,Y. and Blanquet,S.
Structural and biochemical characterization of the Escherichia coli argE gene product
J. Bacteriol. 174 (7), 2323-2331 (1992)
Medline: 92202162

Boyen,A., Charlier,D., Charlier,J., Sakanyan,V., Mett,I. and
Glansdorff,N.
Acetylornithine deacetylase, succinyldiaminopimelate desuccinylase
and carboxypeptidase G2 are evolutionarily related
Gene 116 (1), 1-6 (1992)
Medline: 92331940

Piette,J., Cunin,R., Boyen,A., Charlier,D., Crabeel,M., Van
Vliet,F., Glansdorff,N., Squires,C. and Squires,C.L.
The regulatory region of the divergent argECBH operon in
Escherichia coli K-12
Nucleic Acids Res. 10 (24), 8031-8048 (1982)
Medline: 83143275




Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to acetylornithine deacetylase sequences and a few significant hit to succinyl-diaminopimelate desuccinylase protein sequences, e.g.residues 24-262 are 29% similar to succinyl-diaminopimelate desuccinylase in Haemophilus influenzae strain Rd KW20 (1169224|).

Residues 6-339 are 61% similar to acetylornithine deacetylase in Escherichia coli (114142|).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0624
COG name: Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases
Functional Class: E
The phylogenetic pattern of COG0624 is AM-KYqV-EBRHuj-----nx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001261 (ArgE/dapE/ACY1/CPG2/yscS family) with a combined E-value of 2.3e-10.
    IPB001261A    109-121
    IPB001261B    134-143
    IPB001261C    179-195
***** IPB002933 (Peptidase family M20/M25/M40) with a combined E-value of 6.6e-09.
    IPB002933B    179-195
    IPB002933C    249-262


ProDom Summary:  Protein Domain Search
Residues 230-298 are 44% similar to a (PROTEOME DEACETYLASE COMPLETE) protein domain (PD388370) which is seen in Q9KNT5_VIBCH.

Residues 136-276 are 78% similar to a (PROTEOME COMPLETE HYDROLASE DEACETYLASE) protein domain (PD293379) which is seen in Q9CLT9_PASMU.

Residues 10-116 are 50% similar to a (COMPLETE PROTEOME HYDROLASE DESUCCINYLASE) protein domain (PD001449) which is seen in Q9K4Z7_BBBBB.

Residues 300-339 are 80% similar to a (DEACETYLASE ACETYLORNITHINASE HYDROLASE) protein domain (PD308941) which is seen in Q9CLT9_PASMU.



Paralogs:  Local Blast Search
HD0566 is paralogously related to HD0642 (7e-16).


Pfam Summary:  Pfam Search
Residues 10 to 340 (E-value = 1.5e-60) place HD0566 in the Peptidase_M20 family which is described as Peptidase family M20/M25/M40 (PF01546)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MANTTFIQRYRQLIAIPTISSLVPSEDLSNKALIDTLASWLADFGFNIDI
IEVAGSRNKYNLLATLGEGQGGLLLAGHTDTVPFDQGKWQSDPFVLTEKA
GKFYGLGTADMKGFFAFIVEVLASLDLKKLNKPLRILATADEETTMLGAR
TFAKHTHIRPDCAIIGEPTSLKPIRAHKGHLGQAVRITGKSGHSSDPAKG
INAIDLMHQATGYLINMRNQLRDRYHNDLFQVPYPTMNFGNIHGGDAINR
ICACCELQFDLRPLPNLVIADLYAMVNQNLQPLLEQYGDLIEIRHLHDAI
PGYECPPSSQVVQIVEKLLGEKCDAVNYCTEAPFIQHLCA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAATACTACATTTATTCAACGTTACCGCCAATTGATTGCAATTCC
AACTATTTCTAGCTTAGTGCCGAGTGAAGATTTATCTAATAAAGCATTAA
TTGATACGCTGGCTAGTTGGTTAGCTGATTTTGGCTTTAATATTGATATT
ATTGAAGTAGCAGGTAGCCGTAATAAATATAATTTACTTGCCACACTTGG
TGAAGGGCAAGGCGGTTTATTACTAGCCGGGCACACGGATACGGTCCCTT
TTGACCAAGGAAAGTGGCAATCTGATCCTTTTGTTTTGACAGAAAAAGCG
GGTAAATTTTATGGTTTAGGCACTGCGGATATGAAAGGTTTTTTTGCCTT
TATTGTAGAGGTATTGGCTAGCCTCGATCTCAAAAAATTAAACAAACCTC
TGCGAATTTTAGCCACTGCCGATGAAGAGACAACCATGTTAGGTGCAAGA
ACTTTTGCCAAGCATACACATATTCGCCCAGATTGTGCCATTATTGGCGA
ACCGACTTCGCTAAAACCGATCCGTGCACATAAAGGACACCTTGGACAAG
CGGTCAGAATTACCGGCAAAAGTGGACATTCTAGCGATCCCGCTAAAGGC
ATTAATGCAATTGACTTAATGCACCAAGCAACGGGTTATTTAATAAATAT
GCGTAATCAATTACGCGATCGATATCATAATGATTTATTCCAAGTCCCTT
ATCCAACCATGAACTTTGGCAACATCCACGGTGGAGATGCCATTAATCGC
ATCTGTGCTTGTTGCGAATTACAATTTGATCTACGACCGCTGCCTAATTT
AGTGATTGCAGATCTCTATGCAATGGTCAATCAAAACCTACAACCACTGT
TAGAACAATATGGCGATTTAATTGAAATCCGCCATCTACACGACGCGATT
CCCGGCTACGAATGCCCACCATCATCTCAAGTGGTGCAAATCGTTGAAAA
ACTGCTAGGCGAAAAATGCGATGCCGTCAATTACTGTACAGAAGCCCCTT
TCATTCAACATTTATGTGCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy