Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR390 IGR391 IGR392 IGR389 IGR395 IGR393 IGR394 IGR396 HD0560 pqqIII, - HD0556 HD0558 argE, - HD0566 potE, - HD0568 clpB, - HD0565 HD0559 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555 HD0560 pqqIII, - HD0556 HD0558 argE, - HD0566 potE, - HD0568 clpB, - HD0565 HD0559 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555 pqqIII, - HD0556 HD0558 argE, - HD0566 clpB, - HD0565 HD0567 ygcM, - HD0557 ygcM, - HD0557 potE, - HD0568 HD0560 HD0567 HD0559 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555
* Calculated from Protein Sequence

Gene ID: HD0564

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
aspA  

Definition:
aspartate ammonia-lyase

Gene Start:
430359

Gene Stop:
431786

Gene Length:
1428

Molecular Weight*:
51599

pI*:
4.90

Net Charge*:
-15.27

EC:
4.3.1.1  

Functional Class:
Energy metabolism; Amino acids and amines  

Pathway: pathway table
Alanine and aspartate metabolism
Nitrogen metabolism

Secondary Evidence:
Shi,W., Dunbar,J., Jayasekera,M.M., Viola,R.E. and Farber,G.K.
The structure of L-aspartate ammonia-lyase from Escherichia coli
Biochemistry 36 (30), 9136-9144 (1997)
Medline: 97375637

Woods,S.A., Miles,J.S., Roberts,R.E. and Guest,J.R.
Structural and functional relationships between fumarase and
aspartase. Nucleotide sequences of the fumarase (fumC) and
aspartase (aspA) genes of Escherichia coli K12
Biochem. J. 237 (2), 547-557 (1986)
Medline: 87099873

Takagi,J.S., Ida,N., Tokushige,M., Sakamoto,H. and Shimura,Y.
Cloning and nucleotide sequence of the aspartase gene of
Escherichia coli W
Nucleic Acids Res. 13 (6), 2063-2074 (1985)
Medline: 85215599


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to aspartate ammonia-lyase protein sequences,e.g. residues 1-469 are 87% similar to aspartate ammonia-lyase in Haemophilus influenzae strain Rd KW20 (1168534|).

Residues 2-474 are 78% similar to aspartate ammonia-lyase in Escherichia coli (114272|).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1027
COG name: Aspartate ammonia-lyase
Functional Class:  E
The phylogenetic pattern of COG1027 is ------v-eb-huj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000362 (Fumarate lyase) with a combined E-value of 8.2e-15.
    IPB000362A    187-200
    IPB000362B    319-329


ProDom Summary:  Protein Domain Search
Residues 210-411 are 86% similar to a (LYASE FUMARATE HYDRATASE COMPLETE) protein domain (PD000660) which is seen in ASPA_HAEIN.

Residues 5-207 are 83% similar to a (LYASE HYDRATASE FUMARATE COMPLETE) protein domain (PD002097) which is seen in Q9CLV0_PASMU.

Residues 412-469 are 89% similar to a (LYASE AMMONIA-LYASE ASPARTATE ASPARTASE) protein domain (PD399536) which is seen in ASPA_SERMA.

Residues 210-457 are 42% similar to a (LYASE ADENYLOSUCCINATE BIOSYNTHESIS) protein domain (PD328331) which is seen in ASPA_BACSU.

Residues 412-460 are 87% similar to a (FUMARATE HYDRATASE PROTEOME COMPLETE) protein domain (PD404475) which is seen in Q9CLV0_PASMU.

Residues 412-464 are 49% similar to a (LYASE HYDRATASE FUMARATE FUMARASE) protein domain (PD408744) which is seen in ASPA_PSEFL.



Paralogs:  Local Blast Search


HD0564 is paralogously related to HD1986 (1e-99) and HD1033 (1e-06).


Pfam Summary:  Pfam Search
Residues 12 to 344 (E-value = 7.3e-158) place HD0564 in the Lyase_1 family which is described as Lyase (PF00206)

PDB Hit:
pdb|1JSW|B Chain B, Native L-Aspartate Ammonia Lyase >gi|239239... 746 0.0
pdb|1YFM| Recombinant Yeast Fumarase 310 2e-085
pdb|2FUS|A Chain A, Mutations Of Fumarase That Distinguish Betw... 309 5e-085

Gene Protein Sequence:
MSNVRIEVDLLGEREVPNQVYWGIHTLRAVENFNISNNTISDIPEFVRGM
VMVKKATALANGELGAIPKKVAQAIVQACDEILVNGRCMDQFPSDVYQGG
AGTSVNMNTNEVIANLALEMLGHKKGEYHIIDPMDHVNASQSTNDAYPTG
FRIAVYNSLMHLIEQVLYLQQGFEEKAVEFANVLKMGRTQLQDAVPMTVG
QEFKAFAVLLAEEVRNLKRTAQLLLEVNLGATAIGTGLNTPAGYSELAVK
YLSEVTGLACVLSENLIEATSDCGAYVMVHGALKRTAVKLSKVCNDLRLL
SSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVCFKVIGNDTTVT
FAAEAGQLQLNVMEPVIGQAMFESIAILANACVNLRDKCVDGISVNKEIC
ENFVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKGVREVILEKGLLTEA
QLDDILSVENLMHPIYKAKRFTEDE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTAATGTGCGTATTGAAGTGGATTTACTCGGCGAAAGAGAAGTGCC
AAATCAGGTCTATTGGGGAATTCATACTTTAAGAGCGGTTGAAAATTTTA
ATATTTCTAACAATACTATTTCAGATATACCTGAATTTGTCCGTGGTATG
GTTATGGTGAAAAAAGCCACCGCATTAGCAAATGGCGAATTAGGTGCAAT
TCCCAAAAAAGTGGCACAGGCTATTGTGCAAGCGTGTGATGAAATTTTAG
TGAATGGTCGTTGTATGGATCAATTTCCGTCAGATGTTTATCAAGGCGGT
GCCGGTACCTCGGTTAATATGAACACTAATGAGGTTATTGCTAACTTAGC
GCTTGAAATGCTAGGGCATAAAAAAGGGGAATATCATATTATTGATCCAA
TGGATCACGTTAATGCTAGTCAATCAACGAATGATGCTTATCCTACAGGA
TTCCGCATTGCTGTGTATAACAGCTTAATGCATTTAATTGAACAAGTCCT
TTATTTACAACAGGGCTTTGAAGAGAAAGCGGTCGAATTTGCCAATGTTC
TTAAAATGGGGCGGACACAGTTGCAAGATGCAGTGCCTATGACAGTTGGT
CAAGAATTTAAAGCATTTGCGGTGTTATTAGCAGAAGAAGTACGTAATTT
AAAACGTACTGCTCAATTATTACTTGAGGTTAACTTAGGCGCAACTGCAA
TTGGCACGGGGTTAAATACACCGGCAGGTTATTCAGAATTAGCGGTAAAA
TATTTATCAGAAGTAACAGGTTTAGCTTGTGTTTTATCAGAAAATTTAAT
TGAAGCAACTTCAGATTGTGGTGCTTATGTAATGGTACACGGTGCGTTGA
AACGTACTGCGGTTAAGTTATCTAAAGTATGTAATGATTTACGCTTACTT
TCATCTGGACCTAGAGCGGGTTTGAATGAAATTAATCTGCCGGAATTGCA
AGCGGGTTCTTCTATTATGCCAGCTAAAGTAAATCCAGTGGTACCTGAGG
TGGTTAATCAAGTATGCTTTAAAGTGATAGGTAATGATACAACCGTTACT
TTTGCAGCAGAAGCGGGGCAGTTACAATTGAATGTAATGGAGCCGGTGAT
TGGACAGGCAATGTTTGAATCTATTGCCATTTTAGCAAATGCGTGTGTCA
ATTTACGTGATAAATGCGTCGATGGCATCAGTGTCAATAAAGAAATCTGC
GAAAATTTTGTGTTTAATTCAATTGGGATTGTCACTTATCTTAATCCATT
TATTGGCCATCATAATGGCGATATTGTGGGTAAGATTTGTGCTGAAACGG
GGAAAGGTGTACGTGAAGTCATTCTCGAAAAAGGATTGCTCACCGAAGCT
CAGTTAGATGATATTCTTTCAGTGGAAAATTTAATGCACCCAATTTATAA
AGCAAAACGGTTTACGGAAGATGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy