Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR390 IGR391 IGR392 IGR389 IGR395 IGR388 IGR393 IGR394 IGR396 HD0560 pqqIII, - HD0556 HD0558 argE, - HD0566 clpB, - HD0565 HD0559 HD0554 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555 HD0560 pqqIII, - HD0556 HD0558 argE, - HD0566 clpB, - HD0565 HD0559 HD0554 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555 pqqIII, - HD0556 HD0558 argE, - HD0566 clpB, - HD0565 ygcM, - HD0557 ygcM, - HD0557 HD0560 HD0559 HD0554 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555
* Calculated from Protein Sequence

Gene ID: HD0563

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
429943

Gene Stop:
430230

Gene Length:
288

Molecular Weight*:
11330

pI*:
10.80

Net Charge*:
9.65

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 4-77 are 35% similar to >22958250 hypothetical protein [Rhodobacter sphaeroides]. Residues 3-80 are 43% similar to gi 19746339 of S.pyogenes.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0563 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 12 to 66 (E-value = 7.1e-20) place HD0563 in the DUF1294 family which is described as Protein of unknown function (DUF1294) (PF06961)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIMLVIYAVLINAVCFYLMYWDKRQAVKKMQRIAESNLLFLTAMGGFIGV
FLAIKYLRHKSKKWYFHFTVSLAGLFWLLVLPILYYVLIFNHKNF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAATGTTAGTAATTTATGCAGTATTGATTAACGCGGTTTGCTTTTA
TTTGATGTATTGGGATAAGCGACAAGCGGTAAAAAAAATGCAACGGATCG
CTGAATCGAACTTATTGTTTTTAACGGCAATGGGCGGTTTTATCGGCGTT
TTTTTAGCGATTAAATATCTTCGTCATAAAAGTAAAAAGTGGTATTTCCA
TTTTACTGTGAGTTTGGCAGGGTTATTTTGGCTATTAGTTTTACCTATTT
TATACTACGTTTTAATCTTTAATCATAAGAATTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy