Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR390 IGR391 IGR392 IGR389 IGR395 IGR388 IGR387 IGR393 IGR394 HD0560 pqqIII, - HD0556 HD0558 HD0553 clpB, - HD0565 HD0559 HD0554 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555 HD0560 pqqIII, - HD0556 HD0558 HD0553 clpB, - HD0565 HD0559 HD0554 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555 pqqIII, - HD0556 HD0558 HD0553 clpB, - HD0565 ygcM, - HD0557 ygcM, - HD0557 HD0560 HD0559 HD0554 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555
* Calculated from Protein Sequence

Gene ID: HD0561

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purM  

Definition:
phosphoribosylformylglycinamidine cyclo-ligase

Gene Start:
428930

Gene Stop:
429841

Gene Length:
912

Molecular Weight*:
32223

pI*:
6.20

Net Charge*:
-3.59

EC:
6.3.3.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Li,C., Kappock,T.J., Stubbe,J., Weaver,T.M. and Ealick,S.E.
X-ray crystal structure of aminoimidazole ribonucleotide synthetase (PurM), from the Escherichia coli purine biosynthetic pathway at 2.5-A resolution
Structure 7, 1155-1166 (1999)

Smith,J.M. and Daum,H.A. III.
Nucleotide sequence of the purM gene encoding
5"-phosphoribosyl-5-aminoimidazole synthetase of Escherichia coli
K12
The Journal of biological chemistry. 261 (23), 10632-10636 (1986)
Medline: 86278135

Schrimsher,J.L., Schendel,F.J., Stubbe,J. and Smith,J.M.
Purification and characterization of aminoimidazole ribonucleotide
synthetase from Escherichia coli
Biochemistry. 25 (15), 4366-4371 (1986)
Medline: 87000552

Comment:
This enzyme catalyzes the fifth step, the ATP-dependent synthesis
of 5"-phosphoribosyl-5-aminoimidazole from
5"-phosphoribosylformylglycinamide, in the de novo synthesis of
purine nucleotides.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to phosphoribosylformylglycinamidine cyclo-ligase protein sequences, e.g. residues 1-289 are 88% similar to phosphoribosylaminoimidazole synthetase in Haemophilus influenzae strain Rd KW20 (1172755|).

Residues 4-287 are 78% similar to phosphoribosylformylglycinamidine cyclo-ligase in Escherichia coli K12 (131625|).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0150
COG name: Phosphoribosylaminoimidazol (AIR) synthetase PurM
Functional Class:  F
The phylogenetic pattern of COG0150 is amtkyqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 140-204 are 90% similar to a (SYNTHETASE LIGASE CYCLO-LIGASE) protein domain (PD000644) which is seen in PUR5_HAEIN.

Residues 86-125 are 92% similar to a (SYNTHETASE LIGASE PURINE CYCLO-LIGASE) protein domain (PD398914) which is seen in Q9CPL6_PASMU.

Residues 6-85 are 86% similar to a (SYNTHETASE LIGASE) protein domain (PD096289) which is seen in Q9KPY6_VIBCH.

Residues 213-289 are 87% similar to a (SYNTHETASE LIGASE CYCLO-LIGASE PURINE) protein domain (PD002449) which is seen in PUR5_HAEIN.

Residues 87-139 are 71% similar to a (KINASE COMPLETE PROTEOME HYDROGENASE THIAMINE) protein domain (PD344351) which is seen in Q9KF55_BACHD.

Residues 7-139 are 34% similar to a (PROTEOME COMPLETE CYCLO-LIGASE) protein domain (PD244461) which is seen in Q9X0X8_THEMA.

Residues 2-85 are 50% similar to a (SYNTHETASE GLYCINAMIDE BIOSYNTHETIC) protein domain (PD407182) which is seen in Q9VM53_DROME.

Residues 21-85 are 90% similar to a (SYNTHETASE LIGASE) protein domain (PD405636) which is seen in PUR5_HAEIN.



Paralogs:  Local Blast Search

HD0561 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 164 (E-value = 7e-74) place HD0561 in the AIRS family which is described as AIR synthase related protein, N-terminal domain (PF00586)
Residues 175 to 302 (E-value = 4.1e-17) place HD0561 in the AIRS_C family which is described as AIR synthase related protein, C-terminal domain (PF02769)

PDB Hit:
pdb|1CLI|A Chain A, X-Ray Crystal Structure Of Aminoimidazole R... 459 2e-130

Gene Protein Sequence:
VSNTQLSYKDAGVDIHAGNELVESIKADVKRTRRPEVMGGLGGFGALCSL
PTKYKEPVLVSGTDGVGTKLRLAIDLNKHDTIGQDLVAMCVNDLVVQGAE
PLFFLDYYATGKLEVNVAAEVIKGIADGCEMAGCALVGGETAEMPGMYHA
GDYDLAGFCVGVVEKAEIIDGLAVKAGDTLIALASSGPHSNGYSLIRKVL
EVSGANATDELVGKPLSEHLLAPTKIYVKSVLSLIKQVEVHAIAHLTGGS
FWENIPRVLPKATKAVINEQSWQWPAVFKWLQEKGNISRANASGRKCVGN
WSY$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAGCAATACACAACTTAGCTATAAAGATGCTGGCGTGGATATCCACGC
AGGTAATGAATTAGTAGAAAGCATAAAAGCAGATGTAAAACGTACTCGTC
GCCCGGAAGTGATGGGCGGGCTAGGTGGTTTTGGTGCATTATGCTCATTA
CCCACCAAATATAAAGAACCAGTTTTAGTCTCAGGTACAGATGGTGTAGG
CACTAAACTTCGCTTAGCGATTGATCTCAATAAACACGATACGATTGGGC
AAGATTTAGTGGCTATGTGCGTGAATGATCTAGTGGTACAAGGCGCAGAG
CCATTATTCTTCTTAGATTATTATGCAACGGGTAAATTAGAGGTTAATGT
TGCCGCTGAGGTGATTAAAGGTATTGCTGATGGCTGTGAAATGGCAGGCT
GTGCGTTAGTCGGCGGTGAAACCGCTGAAATGCCGGGAATGTATCACGCG
GGTGATTATGATTTAGCTGGTTTTTGTGTTGGCGTAGTGGAAAAAGCGGA
GATTATTGATGGTTTAGCGGTTAAAGCGGGCGATACATTAATTGCTTTGG
CTTCAAGTGGCCCACACTCAAATGGTTATTCATTGATCCGTAAAGTGTTA
GAAGTCAGTGGCGCAAACGCAACAGATGAATTGGTAGGTAAACCATTAAG
CGAACATTTATTAGCACCTACTAAAATTTACGTTAAATCTGTTTTATCGC
TAATTAAGCAAGTTGAGGTTCACGCTATCGCACATTTAACAGGCGGTAGT
TTTTGGGAAAATATCCCGCGCGTGCTACCTAAAGCCACTAAAGCGGTTAT
TAATGAACAATCTTGGCAATGGCCCGCAGTATTTAAATGGTTACAAGAAA
AAGGTAATATTAGCCGTGCTAACGCAAGCGGGCGAAAATGCGTGGGTAAT
TGGTCATATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy