Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR390 IGR391 IGR392 IGR389 IGR395 IGR388 IGR387 IGR393 IGR385 IGR394 HD0560 pqqIII, - HD0556 HD0558 HD0552 HD0553 clpB, - HD0565 HD0559 HD0554 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555 HD0560 pqqIII, - HD0556 HD0558 HD0552 HD0553 clpB, - HD0565 HD0559 HD0554 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555 pqqIII, - HD0556 HD0558 HD0552 HD0553 clpB, - HD0565 ygcM, - HD0557 ygcM, - HD0557 HD0560 HD0559 HD0554 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555
* Calculated from Protein Sequence

Gene ID: HD0557

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ygcM  

Definition:
6-pyruvoyl-tetrahydropterin synthase

Gene Start:
427898

Gene Stop:
427476

Gene Length:
423

Molecular Weight*:
16040

pI*:
6.00

Net Charge*:
-2.90

EC:
4.2.3.12  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Other  

Pathway: pathway table
Folate biosynthesis

Secondary Evidence:
Nar H, Huber R, Heizmann CW, Thony B, Burgisser D.
Three-dimensional structure of 6-pyruvoyl tetrahydropterin synthase, an enzyme involved in tetrahydrobiopterin biosynthesis.
EMBO J. 1994 Mar 15;13(6):1255-62.
PMID: 8137809

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to hypothetical protein and few significant hits to 6-pyruvoyl tetrahydrobiopterin synthase sequences,e.g. residues 4-143 are 69% similar to a hypothetical protein in H.influenzae strain Rd KW20 (1175542|).

Residues 9-141 are 28% similar to probable 6-pyruvoyl tetrahydrobiopterin synthase in Escherichia coli K12 (2833416|).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0720
COG name: 6-pyruvoyl-tetrahydropterin synthase
Functional Class: H
The phylogenetic pattern of COG0720 is amtK-Qvceb-huj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001914 (6-pyruvoyl tetrahydropterin synthase) with a combined E-value of 2.9e-26.
    IPB001914A    9-18
    IPB001914B    21-35
    IPB001914C    104-114
    IPB001914D    123-140


ProDom Summary:  Protein Domain Search
Residues 4-140 are 68% similar to a (SYNTHASE TETRAHYDROBIOPTERIN PROTEOME) protein domain (PD004049) which is seen in YB90_HAEIN.

Residues 69-140 are 60% similar to a (PROTEOME COMPLETE PM0185) protein domain (PD389395) which is seen in Q9CP70_PASMU.



Paralogs:  Local Blast Search
HD0557 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 138 (E-value = 2.7e-06) place HD0557 in the PTPS family which is described as 6-pyruvoyl tetrahydropterin synthase (PF01242)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MFKIAKEFSFDMAHMLDGHDGKCQNLHGHTYKLQVEVSGELVSNGAKRGM
VMDYSDLKSIVKREILDLMDHAYIYDLNNERESQVAQLLLELDSKVYGIP
SRTTAEQIAKYMFEKLAQVGLPVSLIRLWETPTSYCEYSK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTAAAATTGCAAAAGAATTCAGTTTCGATATGGCACATATGTTAGA
TGGGCACGATGGTAAATGCCAAAATTTACATGGCCATACTTACAAATTAC
AAGTTGAAGTAAGTGGCGAACTGGTCAGTAATGGCGCAAAGCGTGGTATG
GTAATGGACTATAGCGATTTAAAAAGCATTGTTAAACGTGAAATTTTAGA
TCTAATGGATCACGCCTACATTTATGACTTAAACAATGAACGTGAAAGCC
AAGTTGCACAGCTATTGCTTGAACTTGACTCCAAAGTATATGGCATTCCA
TCTCGCACAACTGCAGAACAAATCGCTAAATATATGTTTGAAAAACTTGC
ACAAGTCGGTTTGCCTGTTAGCTTAATTCGTTTATGGGAAACACCAACAT
CTTATTGTGAATATTCTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy