Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR390 IGR391 IGR392 IGR389 IGR388 IGR387 IGR393 IGR385 IGR394 HD0560 pqqIII, - HD0556 HD0558 HD0552 HD0553 dnaE, - HD0551 HD0559 HD0554 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555 HD0560 pqqIII, - HD0556 HD0558 HD0552 HD0553 dnaE, - HD0551 HD0559 HD0554 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555 pqqIII, - HD0556 HD0558 HD0552 HD0553 dnaE, - HD0551 ygcM, - HD0557 ygcM, - HD0557 HD0560 HD0559 HD0554 HD0563 purM, - HD0561 aspA, - HD0564 pepA, - HD0555
* Calculated from Protein Sequence

Gene ID: HD0555

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pepA  

Definition:
aminopeptidase A/I (pepA) (leucyl aminopeptidase) (cytosol aminopeptidase)

Gene Start:
425278

Gene Stop:
426777

Gene Length:
1500

Molecular Weight*:
54160

pI*:
5.10

Net Charge*:
-11.99

EC:
3.4.11.1  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Charlier,D., Hassanzadeh,G., Kholti,A., Gigot,D., Pierard,A. and
Glansdorff,N.
carP, involved in pyrimidine regulation of the Escherichia coli
carbamoylphosphate synthetase operon encodes a sequence-specific
DNA-binding protein identical to XerB and PepA, also required for resolution of ColEI multimers
J.Mol. Biol. 250 (4), 392-406 (1995)
Medline: 95341674

McCulloch,R., Burke,M.E. and Sherratt,D.J.
Peptidase activity of Escherichia coli aminopeptidase A is not
required for its role in Xer site-specific recombination
Molecular microbiology. 12 (2), 241-251 (1994)
Medline: 94335644

Stirling,C.J., Colloms,S.D., Collins,J.F., Szatmari,G. and
Sherratt,D.J.
xerB, an Escherichia coli gene required for plasmid ColE1
site-specific recombination, is identical to pepA, encoding
aminopeptidase A, a protein with substantial similarity to bovine
lens leucine aminopeptidase
EMBO J. 8 (5), 1623-1627 (1989)
Medline: 89356633



Comment:
This protein is presumably involved in the processing and regular turnover of intracellular proteins.It catalyzes the removal of unsubstituted amino-terminal amino acids from various peptides.

For other "pep" genes, see HD1832 (pepD), HD1169 (pepB), HD0976 (pepN).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to leucyl aminopeptidase sequences,e.g.residues 1-497 are 61% similar to leucyl aminopeptidase in Haemophilus influenzae strain Rd KW20 (1168441|).

Residues 1-496 are 60% similar to leucyl aminopeptidase in Escherichia coli (113723|).


COGS Summary:  COGS Search
BeTs to 9 clades of COG0260
COG name: Leucyl aminopeptidase
Functional Class: E
The phylogenetic pattern of COG0260 is -----q-cEbrHujgp--inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000819 (Cytosol aminopeptidase) with a combined E-value of 5e-105.
    IPB000819A    187-196
    IPB000819B    217-255
    IPB000819C    266-281
    IPB000819D    323-365
    IPB000819E    373-388
    IPB000819F    410-457
    IPB000819G    458-472


ProDom Summary:  Protein Domain Search
Residues 52-138 are 37% similar to a (AMINOPEPTIDASE MANGANESE LAP HYDROLASE) protein domain (PD304688) which is seen in AMPA_BUCAI.

Residues 54-465 are 64% similar to a (AMINOPEPTIDASE HYDROLASE LEUCYL LEUCINE) protein domain (PD002804) which is seen in AMPA_PASMU.



Paralogs:  Local Blast Search
HD0555 is paralogously related to HD1169 (3e-50).


Pfam Summary:  Pfam Search
Residues 15 to 147 (E-value = 1e-35) place HD0555 in the Peptidase_M17_N family which is described as Cytosol aminopeptidase family, N-terminal domain (PF02789)
Residues 184 to 490 (E-value = 4.6e-186) place HD0555 in the Peptidase_M17 family which is described as Cytosol aminopeptidase family, catalytic domain (PF00883)

PDB Hit:
pdb|1LAM| Leucine Aminopeptidase (Unligated) >gi|1127256|pdb... 248 1e-066
pdb|1BLL|E Chain E, Leucine Aminopeptidase (E.C.3.4.11.1) Compl... 248 1e-066

Gene Protein Sequence:
MEFSVQSSTIEQLQTECLIVGVYQDHQLSSAAVQLDQVSGGYLTRLLQMG
DLDGSVGQSLLLHNVPNIKSARVLLVGCGKQDELTESQYKKIMQQMMHAI
NATAVQQAVCFLTELMVKQRTIYWNIRFAIESIQASRYVYDVFKSIKAKV
VGKLTQIIFNVANQQDLLEAERGLKHAQAIASGMIYAKNMANCPPNICNP
AYLAELAQGLATDYQQIQTRIVDEAEMATLGMNAYLAVSQGSHNPAFLSV
IEYNHHPDPSAKPIVLVGKGLTFDAGGISLKPSDAMDEMKYDMGGAAAVY
GTMKALAEMQLPLNVVGILAGCENMPDGNAYRPGDILTTMNGLTVEVLNT
DAEGRLVLCDALTYVERFDPACVIDIATLTGACMVALGTHNSGLMSTHNE
LADELFTAASQANDKVWRLPLGEEYQEQLKSNFADLANIGGRFGGAITAG
QFLSNFTQKYRWAHLDIAGTAWQSGVAKGATGRPVPLLAQFLINRAQQE$


Gene Nucleotide Sequence:  Sequence Viewer
ATGGAATTTAGTGTACAAAGTAGCACGATTGAACAATTACAAACAGAATG
CTTGATTGTGGGGGTTTATCAAGATCATCAATTATCATCAGCCGCGGTCC
AATTAGATCAAGTAAGTGGTGGATATCTAACACGTTTATTGCAAATGGGG
GATTTAGATGGTTCAGTCGGACAAAGTTTATTATTACATAATGTGCCAAA
TATCAAATCAGCGCGGGTGTTATTAGTCGGTTGTGGCAAACAAGATGAAT
TAACCGAAAGTCAGTATAAAAAAATTATGCAACAAATGATGCATGCCATT
AATGCCACGGCGGTTCAGCAAGCGGTCTGTTTTTTAACCGAATTAATGGT
GAAGCAACGTACAATTTACTGGAATATTCGTTTTGCGATAGAAAGCATTC
AAGCTAGTCGCTATGTGTATGATGTATTTAAAAGCATAAAAGCGAAGGTT
GTGGGTAAGTTAACGCAGATTATTTTTAATGTGGCTAATCAACAAGATTT
GCTTGAGGCAGAACGTGGGTTAAAGCACGCACAAGCGATTGCAAGCGGTA
TGATTTATGCAAAAAATATGGCGAATTGTCCACCTAATATTTGTAATCCG
GCTTATTTAGCTGAATTAGCTCAAGGATTAGCCACTGATTATCAACAGAT
TCAGACGCGGATTGTAGATGAAGCAGAGATGGCAACCTTAGGTATGAATG
CGTATTTAGCGGTGTCTCAAGGATCGCATAATCCCGCCTTTTTATCAGTG
ATTGAATATAATCATCATCCTGATCCAAGCGCTAAACCGATTGTATTAGT
AGGTAAAGGCTTAACATTTGATGCGGGGGGCATTTCGCTCAAACCATCTG
ATGCAATGGATGAAATGAAATATGATATGGGCGGTGCGGCTGCGGTTTAT
GGCACGATGAAAGCACTAGCGGAAATGCAATTACCATTAAATGTAGTGGG
TATTCTTGCCGGTTGTGAAAATATGCCAGATGGCAACGCTTATCGCCCAG
GGGATATCTTAACTACGATGAATGGTTTAACGGTGGAAGTATTAAATACG
GATGCTGAAGGTCGTTTAGTATTATGCGATGCATTAACTTATGTAGAACG
TTTTGATCCCGCTTGTGTGATTGACATTGCTACCCTAACAGGGGCTTGTA
TGGTTGCTTTAGGGACACACAATAGCGGTTTAATGTCTACGCATAATGAG
TTGGCTGATGAGTTATTCACTGCAGCAAGCCAGGCAAATGATAAAGTATG
GCGTTTACCTCTAGGTGAAGAATATCAAGAGCAATTGAAGTCAAATTTTG
CCGATCTTGCTAATATTGGTGGTCGTTTTGGTGGGGCTATTACGGCAGGA
CAATTTTTATCTAACTTTACGCAAAAATACCGTTGGGCTCATTTAGATAT
CGCCGGCACGGCTTGGCAATCAGGCGTAGCAAAAGGCGCAACAGGCAGAC
CTGTGCCATTACTTGCGCAATTCCTAATAAATAGGGCTCAACAGGAATAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy