Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR384 IGR388 IGR387 IGR383 IGR385 HD0552 HD0553 dnaE, - HD0551 HD0554 purN, - HD0548 pepA, - HD0555 plsB, - HD0546 HD0552 HD0553 dnaE, - HD0551 HD0554 purN, - HD0548 pepA, - HD0555 plsB, - HD0546 HD0552 HD0553 dnaE, - HD0551 HD0554 purN, - HD0548 pepA, - HD0555 plsB, - HD0546
* Calculated from Protein Sequence

Gene ID: HD0551

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dnaE  

Definition:
DNA polymerase III alpha subunit protein, dnaE

Gene Start:
422653

Gene Stop:
419177

Gene Length:
3477

Molecular Weight*:
129603

pI*:
5.40

Net Charge*:
-22.97

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Li,S.J. and Cronan,J.E. Jr.
Growth rate regulation of Escherichia coli acetyl coenzyme A
carboxylase, which catalyzes the first committed step of lipid
biosynthesis
J. Bacteriol. 175 (2), 332-340 (1993)
Medline: 93123150

Fijalkowska,I.J. and Schaaper,R.M.
Antimutator mutations in the alpha subunit of Escherichia coli DNA
polymerase III: identification of the responsible mutations and
alignment with other DNA polymerases
Genetics 134 (4), 1039-1044 (1993)
Medline: 93387658

O"Donnell,M.
Accessory protein function in the DNA polymerase III holoenzyme
from E. coli
Bioessays 14 (2), 105-111 (1992)
Medline: 92246902

Tomasiewicz,H.G. and McHenry,C.S.
Sequence analysis of the Escherichia coli dnaE gene
J. Bacteriol. 169 (12), 5735-5744 (1987)
Medline: 88058791

Comment:
From Genbank:[gi:1169392]
DNA Polymerase III is a complex,multichain enzyme responsible for most of the replicative synthesis in bacteria.It also exhibits 3" to 5" exonuclease activity.The alpha chain is the DNA polymerase.


For other "dna" genes, see HD1372 (dnaB), HD1771 (dnaJ), HD1819 (dnaX), HD0189 (dnaK), HD1935 (dnaX), HD0973 (dnaB), HD0690 (dnaG), HD0850 (dnaN), HD0851 (dnaA)

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to DNA polymerase III alpha subunit protein sequences, e.g. residues 2-1158 are 75% similar to DNA polymerase III, alpha subunit of Haemophilus influenzae strain Rd KW20 (1169392|).

Residues 1-1158 are 70% similar to DNA polymerase III,alpha subunit in Escherichia coli (118794|).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0587
COG name: DNA-dependent DNA polymerase III alpha chain
Functional Class: L
The phylogenetic pattern of COG0587 is -----qvCeBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003141 (PHP domain N-terminal region) with a combined E-value of 2.6e-31.
    IPB003141A    7-44
    IPB003141B    387-402
    IPB003141C    753-763


ProDom Summary:  Protein Domain Search
Residues 389-715 are 86% similar to a (DNA POLYMERASE III REPLICATION) protein domain (PD004180) which is seen in DP3A_PASMU.

Residues 66-146 are 53% similar to a (DNA POLYMERASE SUBUNIT TRANSFERASE) protein domain (PD391953) which is seen in DP3A_ECOLI.

Residues 755-1135 are 62% similar to a (DNA POLYMERASE III REPLICATION) protein domain (PD004426) which is seen in DP3A_ECOLI.

Residues 357-388 are 96% similar to a (DNA POLYMERASE SUBUNIT ALPHA) protein domain (PD005473) which is seen in DP3A_ECOLI.

Residues 1-75 are 56% similar to a (DNA POLYMERASE III DNA-DIRECTED) protein domain (PD001693) which is seen in DP3A_PASMU.

Residues 1076-1158 are 59% similar to a (DNA POLYMERASE SUBUNIT TRANSFERASE) protein domain (PD352075) which is seen in DP3A_HAEIN.

Residues 1057-1157 are 28% similar to a (DNA POLYMERASE SUBUNIT TRANSFERASE) protein domain (PD285026) which is seen in DP3A_PSEFL.

Residues 723-754 are 84% similar to a (DNA POLYMERASE SUBUNIT TRANSFERASE) protein domain (PD281148) which is seen in DP3A_PASMU.

Residues 84-355 are 73% similar to a (DNA POLYMERASE III REPLICATION) protein domain (PD003212) which is seen in DP3A_PASMU.



Paralogs:  Local Blast Search


HD0551 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 72 (E-value = 4.2e-24) place HD0551 in the PHP_N family which is described as PHP domain N-terminal region (PF02231)
Residues 80 to 209 (E-value = 2.9e-29) place HD0551 in the PHP_C family which is described as PHP domain C-terminal region (PF02811)
Residues 992 to 1071 (E-value = 1.1e-12) place HD0551 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTQPRFVHLKVHSDFSMINGLAKVKALVKTAAAKQMAAMALTDFSNFCGL
VKFYGESLTAGLKPIIGADIYVRSDPTSEDIFELTLLAKNNQGYHNITVL
LSRAYQQGYVEFPIVEKAWLAELNEGIIVLSGGRSGDVGKALLKENEQEA
ATLVAFYQQYFADHYYLSLCRTGRSDEERYLQQAVQFAKKYQLPLVAVND
VVFLKEDDFDAHEIRVAIHDSYTLDDPKRPQKYSPQQYFRSEEEMCALFA
DLPQALMNSIQIAMRCNVTIRLGEYFLPNFPTGELSTEDFLIKKSQEGLE
ERLAFLFPDAETRKNKRSVYDERLQVELDVINQMGFPGYFLIVMEFIQWS
KDNDIPVGPGRGSGAGSLVAYALKITDLDPLQFDLLFERFLNPERISMPD
FDVDFCMDGRDHVIEHVADTYGRQAVSQIITFGTMAAKAVIRDVGRVLGH
PYNFVDRISKLIPADPGMTLAKAFEAEPKLPELYNADEEVKDLIDMARKL
EGVTRNAGKHAGGVVIAPTAITDFSPLYCDSEGLHPVTHFDKNDVEYAGL
VKFDFLGLRTLTIIKWALEMINQRLTREGKPPIRIENIPLDDKPSFKLLL
AAKTTAVFQLESRGMKDLISRLKPDCFEDIIALVALFRPGPLESGMVQNF
IDRKHGIEEVSYPDAQYQHECLKPILEPTYGIIVYQEQVMQIAQELAGYT
LGSADLLRRAMGKKKPEEMAAQRDIFEKGAIEKGIDGQLAIKIFDLVEKF
AGYGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTSEMDNTDKIVGLY
DECINMGLTVVPPDVNSGKHRFSVNEKGQIVYGLGAIKGVGEGPIEAILE
ARNKGGIFKDLFDLTARVDLKKINRRTFESLIMSGAFDKLGPHRAALMKN
LEDALKASDQHSKMEALGQSDMFGVLTETPEQVQKAYANTPKWSEQAVLE
GERTTLGLYLSGHPIGRFLKELAHYAPTRLNELQPTRRGQMVTVAGIIVA
SRIAVTKRGSRLGIATLEDRAGKIDITLFSEALENYGDLLVKDNIIIATG
SVQSDDFNGGLKMSVREIANLDEIRSRYAKSLALAISQQQLTPQFVKALR
EIIEPYKEGTLPLHFYYQSPEGRALLRGGVEWRVTPKDEMLDKLAVLLGE
NAVELEFE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTCAACCACGCTTTGTTCATCTTAAAGTACACAGTGATTTTTCTAT
GATTAATGGGCTTGCTAAAGTAAAAGCCTTAGTCAAAACTGCCGCTGCCA
AACAGATGGCTGCAATGGCGTTGACTGATTTTAGTAACTTTTGTGGCTTA
GTGAAATTTTATGGTGAATCATTAACTGCCGGCTTAAAGCCAATTATTGG
TGCTGATATTTATGTTCGTTCTGATCCAACTAGTGAAGATATTTTTGAAC
TGACACTATTAGCAAAAAATAATCAAGGCTATCACAATATCACTGTTCTA
CTTTCTCGTGCTTATCAGCAAGGTTATGTTGAGTTTCCTATTGTCGAAAA
AGCGTGGCTAGCTGAATTAAATGAGGGAATCATTGTACTTTCAGGCGGAC
GTTCAGGTGATGTGGGCAAAGCTTTACTTAAAGAAAATGAACAAGAAGCC
GCCACATTAGTGGCTTTTTATCAACAATATTTCGCGGATCACTATTATCT
TTCTCTTTGTCGAACAGGGCGCTCAGATGAGGAACGTTACCTTCAGCAAG
CGGTTCAATTTGCCAAAAAATATCAATTACCTTTAGTCGCAGTCAATGAC
GTAGTCTTCTTGAAAGAAGATGATTTTGATGCACACGAAATTCGGGTTGC
CATTCACGATAGTTATACACTCGACGATCCCAAACGCCCTCAAAAATACT
CTCCGCAACAATATTTTCGTTCAGAAGAAGAAATGTGCGCCTTATTTGCC
GACTTACCACAAGCGTTGATGAATAGCATTCAAATTGCAATGCGTTGTAA
TGTAACAATACGGCTAGGAGAATATTTTCTTCCCAACTTCCCAACCGGCG
AACTTTCTACGGAAGATTTCCTGATCAAAAAATCACAAGAAGGATTAGAA
GAACGATTAGCCTTTTTATTTCCAGATGCTGAAACACGAAAAAATAAGCG
CTCAGTTTATGATGAACGTTTGCAAGTTGAGCTTGATGTAATCAATCAAA
TGGGCTTTCCAGGTTATTTTTTAATCGTAATGGAATTTATTCAATGGTCA
AAAGATAATGATATCCCGGTTGGTCCTGGACGGGGTTCTGGCGCAGGTTC
ATTAGTTGCTTATGCCCTCAAGATTACCGATCTAGACCCATTACAATTTG
ATTTGCTATTTGAACGTTTCTTAAATCCCGAACGTATTTCCATGCCCGAT
TTTGATGTCGATTTCTGTATGGATGGACGCGATCACGTGATTGAACACGT
AGCAGATACATACGGCCGTCAAGCCGTATCACAAATTATTACTTTTGGCA
CTATGGCGGCTAAAGCAGTTATTCGCGATGTTGGACGAGTGCTTGGCCAT
CCATATAATTTTGTCGATAGAATTTCAAAATTGATTCCCGCAGATCCTGG
CATGACTTTAGCAAAAGCCTTTGAGGCGGAACCGAAATTGCCAGAATTAT
ATAATGCCGATGAAGAAGTAAAAGATCTAATCGATATGGCACGCAAGCTT
GAAGGAGTAACGCGTAATGCGGGCAAACACGCAGGAGGTGTCGTGATTGC
GCCGACGGCAATCACCGATTTTTCACCGCTTTACTGCGATTCAGAAGGCT
TACATCCAGTCACGCATTTTGATAAAAACGATGTTGAATATGCCGGCTTA
GTCAAATTTGACTTCTTAGGTCTGCGAACATTAACCATTATCAAATGGGC
ATTGGAGATGATTAACCAACGGTTAACGCGTGAGGGTAAGCCACCAATAC
GGATCGAAAACATTCCACTTGATGATAAACCATCATTTAAATTGCTGTTA
GCCGCCAAAACTACCGCAGTCTTTCAGCTAGAATCCCGCGGGATGAAAGA
TTTAATCTCACGCCTTAAGCCTGACTGTTTTGAAGATATTATCGCATTAG
TTGCCTTATTCCGTCCCGGCCCACTTGAGTCAGGAATGGTACAAAACTTT
ATAGATCGTAAACACGGTATTGAAGAAGTTTCTTACCCAGATGCACAATA
TCAACATGAATGTTTAAAACCTATTCTTGAGCCTACTTATGGTATAATTG
TTTATCAAGAACAAGTCATGCAAATTGCTCAAGAATTAGCCGGATATACA
CTCGGCAGTGCTGATTTATTACGCCGGGCAATGGGTAAAAAGAAACCGGA
GGAAATGGCAGCTCAACGTGATATTTTTGAAAAAGGCGCCATTGAAAAGG
GGATTGATGGCCAGTTAGCAATAAAAATTTTTGATTTAGTGGAAAAATTC
GCCGGTTATGGTTTTAATAAATCGCACTCTGCTGCTTATGCTTTGGTTTC
CTATCAAACACTTTGGTTAAAAGCACATTATCCCGCTGAATTTATGGCAG
CCGTTATGACTTCTGAGATGGATAATACTGATAAAATCGTTGGGCTTTAT
GATGAATGTATCAATATGGGATTAACCGTGGTGCCTCCCGATGTTAACAG
TGGCAAGCATCGCTTTTCAGTCAATGAAAAAGGGCAAATTGTGTATGGTT
TAGGCGCAATCAAAGGTGTGGGTGAAGGCCCAATCGAAGCAATTCTAGAA
GCACGTAACAAAGGCGGTATCTTTAAAGATTTATTCGATTTAACTGCCCG
TGTTGATCTGAAAAAAATCAATCGCCGTACGTTTGAGAGTCTGATTATGT
CAGGAGCATTTGATAAATTAGGCCCCCATCGTGCAGCCTTAATGAAAAAT
TTAGAAGATGCGCTTAAAGCGTCTGATCAACATAGTAAAATGGAAGCACT
CGGACAAAGTGATATGTTTGGCGTGTTAACAGAAACCCCTGAACAAGTCC
AAAAAGCGTATGCAAATACCCCTAAATGGTCTGAACAAGCGGTATTAGAA
GGCGAACGAACAACCTTAGGTTTATACTTGAGTGGCCACCCAATCGGCCG
TTTCTTAAAAGAACTTGCTCATTATGCGCCAACAAGGCTAAATGAATTAC
AACCGACACGGCGTGGGCAAATGGTCACAGTGGCGGGTATTATCGTTGCA
TCTCGCATTGCAGTAACCAAACGTGGCAGCCGTTTAGGTATTGCTACACT
TGAAGATCGTGCTGGCAAAATTGATATTACATTATTTTCTGAAGCCTTAG
AAAATTATGGCGATTTATTAGTAAAAGATAACATTATTATCGCCACTGGT
TCAGTACAGTCTGATGATTTTAACGGTGGTTTGAAAATGTCGGTCAGAGA
GATTGCCAATTTAGATGAAATCCGTAGCCGATATGCCAAAAGCCTTGCAC
TTGCTATTAGCCAACAACAACTTACACCGCAATTTGTGAAAGCGTTACGT
GAAATCATTGAACCCTATAAAGAAGGCACACTGCCATTACATTTTTACTA
TCAAAGCCCTGAAGGGCGAGCATTATTACGTGGCGGGGTAGAATGGCGTG
TTACGCCCAAAGATGAAATGCTAGATAAATTAGCCGTTTTACTAGGTGAA
AATGCGGTCGAACTAGAATTTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy