Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR380 IGR378 IGR381 IGR377 IGR384 IGR383 IGR382 IGR379 IGR376 HD0540 trmA, - HD0541 lexA, - HD0545 mutH, - HD0544 nagZ,hexA, - HD0542 dnaE, - HD0551 HD0539 purN, - HD0548 plsB, - HD0546 HD0540 trmA, - HD0541 lexA, - HD0545 mutH, - HD0544 nagZ,hexA, - HD0542 dnaE, - HD0551 HD0539 purN, - HD0548 plsB, - HD0546 trmA, - HD0541 lexA, - HD0545 mutH, - HD0544 nagZ,hexA, - HD0542 dnaE, - HD0551 HD0540 HD0539 purN, - HD0548 plsB, - HD0546
* Calculated from Protein Sequence

Gene ID: HD0546

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
plsB  

Definition:
glycerol-3-phosphate acyltransferase protein

Gene Start:
415386

Gene Stop:
417821

Gene Length:
2436

Molecular Weight*:
92879

pI*:
9.40

Net Charge*:
11.71

EC:
2.3.1.15  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Heath,R.J. and Rock,C.O.
A missense mutation accounts for the defect in the
glycerol-3-phosphate acyltransferase expressed in the plsB26 mutant
J. Bacteriol. 181 (6), 1944-1946 (1999)
Medline: 99173924

Green,P.R., Vanaman,T.C., Modrich,P. and Bell,R.M.
Partial NH2- and COOH-terminal sequence and cyanogen bromide
peptide analysis of Escherichia coli sn-glycerol-3-phosphate
acyltransferase
J. Biol. Chem. 258 (18), 10862-10866 (1983)
Medline: 83291032

Lewin TM, Wang P, Coleman RA.
Analysis of amino acid motifs diagnostic for the sn-glycerol-3-phosphate acyltransferase reaction.
Biochemistry. 1999 May 4;38(18):5764-71.
PMID: 10231527



Comment:
For other "pls" genes, see HD0049 (plsC) and HD0773 (plsX).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glycerol-3-phosphate acyltransferase protein sequences, e.g.residues 1-806 are 67% similar to glycerol-3-phosphate acyltransferase of Haemophilus influenzae strain Rd KW20 (1172533|).

Residues 1-799 are 57% similar to glycerol-3-phosphate acyltransferase of Escherichia coli (3915793|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 428-470 are 93% similar to a (ACYLTRANSFERASE GLYCEROL-3-PHOSPHATE) protein domain (PD346393) which is seen in PLSB_HAEIN.

Residues 204-329 are 77% similar to a (ACYLTRANSFERASE GLYCEROL-3-PHOSPHATE) protein domain (PD037846) which is seen in PLSB_HAEIN.

Residues 472-797 are 57% similar to a (ACYLTRANSFERASE GLYCEROL-3-PHOSPHATE) protein domain (PD042027) which is seen in PLSB_HAEIN.

Residues 1-202 are 63% similar to a (ACYLTRANSFERASE GLYCEROL-3-PHOSPHATE) protein domain (PD269467) which is seen in PLSB_HAEIN.

Residues 333-427 are 72% similar to a (ACYLTRANSFERASE COMPLETE PROTEOME) protein domain (PD000989) which is seen in Q9CLN7_PASMU.



Paralogs:  Local Blast Search
HD0546 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 278 to 422 (E-value = 5.2e-43) place HD0546 in the Acyltransferase family which is described as Acyltransferase (PF01553)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSSLLSFYRNILNFPLSLLVKSQAIPTDPVSELGLNLEQPIIYVLPYTSQ
TDLLILQKNCLALNLPDPLVENDIQGQSLPRYVFLDEGHRFFKSKGVKSE
TESLFYRYLDLHKTDETLDVQLVPVSVLWGRSPGKETAPSLRLLSRFQRI
IAMIWFGRDNFVRFSQAVSLCYMVKEYGAEKGIAQKLARVAKIHFAKQRY
SAMGPRLPERQAMFDKLIQLPTIVQAIEDEAKTKKIPIPKARQEAEKILD
EIAADVSHGTLRMADRVLSWLWNKLYQGINVQNADRVRKLALEGHEIIYV
PCHRSHMDYLLLSYILYHQGVVPPHIAAGINLNFWPAGPFFRRGGAFFIR
RTFKGNRLYSTVFREYLAELFYRGYSVEYFIEGGRSRTGRLLEPKTGMVS
MTLQALQRGLNRPISIVPVYIGYEHVLEVDTYAKELRGAAKEKENAELVL
RVIKKLRNLGQGYVNFGKPIQVNSYLNQHFPEWKLPPVENVRPKWLNEAV
DAIAKQVMVNINNAAAVNAKNLIGSVLLASRQRALSREQLIEQVESYLQL
FQNVSYSSDIILPTESADEMLEHVLALPRSGVMSEKDNFGEMIRLDRESA
VLMTYYRNNIQHLFVLPSLVASIVLHNEAASKTLIRETVSHIYPFLKAEL
FLHFDEKEVLEQVELILTEFIRQQIVKYDGDVLTINRRRLPTLQLHAAGI
REILQRYYISLSLLLECPAISRTLLEKESRMIAQRLSILHGINAPEFFDK
AIFSTFTASLKAQGYFDLEGHTVIEKVEEVAHILRRLISVEVQLTIQGAM
DKVDQIDEKLE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAGCCTCTTGAGTTTTTATCGTAATATATTGAATTTCCCTTTATC
TTTATTGGTGAAATCACAAGCTATTCCAACCGATCCCGTGAGTGAGTTAG
GCTTGAATTTAGAGCAACCTATTATTTATGTGTTGCCATATACTTCACAA
ACTGATCTGCTTATTCTGCAAAAAAATTGTCTTGCCTTAAACCTGCCTGA
TCCGTTAGTTGAAAATGATATTCAAGGTCAATCTTTACCGCGTTATGTTT
TTCTTGATGAAGGTCATCGCTTTTTCAAGTCAAAAGGGGTAAAAAGTGAA
ACAGAATCTTTGTTTTATCGTTATTTAGATTTACATAAAACAGATGAAAC
GTTAGATGTGCAATTAGTGCCTGTTTCTGTGTTATGGGGGCGCTCACCTG
GTAAAGAAACAGCACCTTCATTGCGTTTATTAAGTCGCTTTCAACGTATT
ATTGCGATGATTTGGTTTGGTCGAGATAATTTTGTTCGTTTTTCGCAAGC
GGTATCATTATGTTATATGGTGAAAGAATATGGTGCAGAAAAAGGCATTG
CACAAAAATTAGCGAGAGTGGCAAAAATTCATTTTGCGAAACAGCGTTAT
TCAGCGATGGGGCCTCGCTTACCCGAACGTCAGGCAATGTTTGATAAATT
AATTCAATTACCCACCATCGTGCAAGCTATTGAAGATGAAGCCAAAACCA
AAAAGATACCTATTCCCAAGGCACGCCAGGAAGCGGAAAAAATCCTTGAT
GAAATTGCGGCGGATGTTAGCCACGGAACATTACGGATGGCAGATCGTGT
GTTGAGTTGGTTGTGGAATAAATTATATCAAGGTATTAACGTACAAAATG
CTGATCGTGTGCGTAAATTAGCGTTGGAAGGGCATGAGATAATTTATGTG
CCTTGCCATCGTAGCCATATGGATTATTTATTACTTTCATATATTTTGTA
TCATCAAGGCGTTGTGCCACCGCATATTGCGGCTGGAATCAATTTAAACT
TTTGGCCTGCGGGTCCGTTTTTCCGCCGTGGTGGTGCTTTCTTTATTCGT
CGTACTTTTAAAGGGAATCGTCTATATTCGACAGTTTTCCGTGAATATTT
AGCGGAATTATTTTATCGTGGCTATTCGGTTGAATATTTTATTGAAGGTG
GTCGTTCTAGAACCGGGCGTTTGTTAGAGCCAAAAACGGGGATGGTGTCA
ATGACATTACAAGCATTACAGCGTGGTTTAAACCGCCCAATTAGTATTGT
TCCTGTTTATATTGGTTATGAACATGTTTTAGAAGTTGATACTTATGCCA
AAGAATTACGCGGTGCTGCTAAGGAAAAAGAAAATGCAGAGCTTGTTTTA
CGTGTGATTAAAAAATTGCGTAATTTAGGGCAGGGGTATGTGAATTTTGG
TAAACCGATCCAAGTAAATAGCTATTTGAACCAGCATTTTCCTGAATGGA
AATTACCGCCTGTGGAAAATGTACGGCCAAAATGGTTAAATGAGGCTGTA
GATGCGATTGCAAAACAAGTGATGGTAAATATCAATAATGCTGCTGCAGT
AAATGCTAAAAATTTAATTGGCTCAGTCTTATTAGCTTCTCGTCAAAGGG
CGTTATCACGCGAGCAATTAATCGAACAAGTGGAAAGTTATTTACAATTA
TTCCAAAATGTGAGTTATTCATCAGATATTATTTTACCCACTGAAAGTGC
GGATGAAATGCTTGAACACGTGTTGGCATTACCTCGGTCAGGGGTGATGA
GTGAGAAAGATAACTTTGGTGAAATGATTCGCTTAGATCGAGAATCAGCC
GTATTAATGACCTATTATCGGAATAATATTCAGCATTTATTCGTTTTGCC
GTCATTAGTGGCGAGTATCGTTTTACATAATGAAGCAGCGTCTAAAACAT
TGATTCGTGAAACGGTGAGCCACATTTATCCATTCTTAAAAGCGGAGCTA
TTTTTACATTTTGATGAAAAAGAGGTGTTAGAGCAAGTTGAGCTGATCTT
AACGGAATTTATTCGTCAACAAATAGTGAAATATGATGGTGACGTGTTAA
CCATTAACCGTCGTCGTTTGCCAACCTTGCAATTACACGCGGCGGGGATA
CGTGAAATTCTACAGCGTTATTATATTAGCTTAAGCCTTTTATTGGAGTG
CCCAGCCATTAGTCGTACTCTATTAGAAAAAGAGAGCAGAATGATTGCTC
AACGTCTTTCTATTTTACATGGCATTAATGCGCCAGAGTTCTTTGATAAA
GCAATTTTTTCAACCTTTACAGCCAGCCTAAAAGCACAAGGTTATTTTGA
TCTAGAAGGTCATACTGTGATTGAAAAAGTTGAAGAAGTGGCACACATTT
TAAGAAGATTGATTTCTGTTGAAGTGCAATTGACTATTCAAGGGGCTATG
GACAAAGTTGACCAAATTGATGAAAAATTAGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy