Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR380 IGR378 IGR381 IGR377 IGR384 IGR383 IGR382 IGR379 IGR376 HD0540 trmA, - HD0541 lexA, - HD0545 mutH, - HD0544 nagZ,hexA, - HD0542 dnaE, - HD0551 HD0539 purN, - HD0548 plsB, - HD0546 HD0538 HD0540 trmA, - HD0541 lexA, - HD0545 mutH, - HD0544 nagZ,hexA, - HD0542 dnaE, - HD0551 HD0539 purN, - HD0548 plsB, - HD0546 HD0538 trmA, - HD0541 lexA, - HD0545 mutH, - HD0544 nagZ,hexA, - HD0542 dnaE, - HD0551 HD0540 HD0539 purN, - HD0548 plsB, - HD0546 HD0538
* Calculated from Protein Sequence

Gene ID: HD0544

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
mutH  

Definition:
DNA mismatch repair protein

Gene Start:
414544

Gene Stop:
413864

Gene Length:
681

Molecular Weight*:
25717

pI*:
7.20

Net Charge*:
0.40

EC:
3.1.21.4  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Ban,C. and Yang,W.
Structural basis for MutH activation in E.coli mismatch repair and
relationship of MutH to restriction endonucleases
EMBO J. 17 (5), 1526-1534 (1998)
Medline: 98151376

Grafstrom,R.H. and Hoess,R.H.
Nucleotide sequence of the Escherichia coli mutH gene
Nucleic Acids Res. 15 (7), 3073-3084 (1987)
Medline: 87174827



Comment:
From Genbank:[gi:730086]
This enzyme is a sequence-specific endonuclease that cleaves unmethylated GATC sequences. It is involved in DNA mismatch repair.

For other "mut" genes, see HD1786 (mutT), HD2004 (mutY), HD2024 (mutS), HD0743 (mutL).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to DNA mismatch repair protein; e.g. residues 7-223 are 60% similar to DNA mismatch repair protein of Haemophilus influenzae strain Rd KW20 (1171079|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 7-221 are 64% similar to a (REPAIR DNA MISMATCH PROTEOME) protein domain (PD037848) which is seen in Q9CLY2_PASMU.



Paralogs:  Local Blast Search

HD0544 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 54 to 153 (E-value = 1.7e-43) place HD0544 in the MutH family which is described as DNA mismatch repair enzyme MutH (PF02976)

PDB Hit:
pdb|2AZO|B Chain B, Dna Mismatch Repair Protein Muth From E. Co... 266 2e-072
pdb|1AZO| Dna Mismatch Repair Protein Muth From E. Coli 261 6e-071
pdb|2AZO|B Chain B, Dna Mismatch Repair Protein Muth From E. Co... 392 3e-110

Gene Protein Sequence:
MQLSIQPQSEAELLAKANWLAGFTLGELAQQLNTVVPPDLTRDKGWVGQI
IERALGATAGSKPEQDFAHLGIELKTIPINNHGLPLETTFICLAPLIHNQ
GITWQTSHVKYKLQRVLWIPIQAERSIPIKDRYIGRAILWSPSYQQEQQL
RNDWEELMEYIVLGRLDQINGHLGEVMQLRPKGRNRLSITQSIDQHGEQI
QSLPLAFYLRKPFTAAILQNFLQQSD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAACTTTCAATCCAACCACAAAGTGAAGCCGAATTATTAGCAAAAGC
AAATTGGCTAGCAGGATTCACATTGGGTGAACTTGCACAACAGTTAAATA
CTGTTGTGCCTCCTGATCTAACTAGAGATAAAGGCTGGGTCGGGCAAATA
ATTGAGCGCGCTTTAGGCGCCACAGCAGGCAGTAAACCTGAACAAGACTT
TGCTCATTTAGGTATTGAGCTTAAAACGATCCCCATCAATAATCATGGTT
TGCCACTTGAAACCACCTTTATTTGCCTTGCACCACTTATACATAATCAA
GGCATCACTTGGCAAACATCGCATGTAAAATATAAATTACAACGTGTACT
TTGGATCCCCATTCAAGCTGAAAGAAGCATTCCGATTAAGGATCGTTATA
TTGGGCGAGCTATTCTTTGGAGCCCTTCTTATCAACAAGAACAACAGCTT
CGTAACGACTGGGAGGAATTAATGGAATATATCGTGCTTGGGCGACTAGA
TCAAATAAATGGACATTTAGGTGAAGTGATGCAATTACGCCCTAAAGGCC
GTAACCGCTTATCCATCACCCAATCGATTGACCAACATGGTGAACAAATA
CAATCATTACCATTAGCTTTTTATTTACGTAAACCATTCACAGCTGCTAT
TCTACAAAATTTTCTACAGCAATCTGACTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy