Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR380 IGR375 IGR378 IGR381 IGR377 IGR383 IGR382 IGR379 IGR376 HD0540 trmA, - HD0541 lexA, - HD0545 mutH, - HD0544 nagZ,hexA, - HD0542 HD0536 HD0535 HD0539 purN, - HD0548 plsB, - HD0546 HD0538 HD0540 trmA, - HD0541 lexA, - HD0545 mutH, - HD0544 nagZ,hexA, - HD0542 HD0536 HD0535 HD0539 purN, - HD0548 plsB, - HD0546 HD0538 trmA, - HD0541 lexA, - HD0545 mutH, - HD0544 nagZ,hexA, - HD0542 HD0540 HD0535 HD0539 purN, - HD0548 plsB, - HD0546 HD0538 HD0536
* Calculated from Protein Sequence

Gene ID: HD0542

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nagZ  hexA  

Definition:
beta-hexosaminidase

Gene Start:
413848

Gene Stop:
412799

Gene Length:
1050

Molecular Weight*:
39483

pI*:
6.90

Net Charge*:
-0.58

EC:
3.2.1.52  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Aminosugars metabolism
Glycoprotein degradation
Glycosaminoglycan degradation
Sphingoglycolipid metabolism

Secondary Evidence:
Yem,D.W. and Wu,H.C.
Purification and properties of beta-N-acetylglucosaminidase from
Escherichia coli
J. Bacteriol. 125 (1), 324-331 (1976)
Medline: 76094894

Cheng,Q., Li,H., Merdek,K. and Park,J.T.
Molecular characterization of the beta-N-acetylglucosaminidase of
Escherichia coli and its role in cell wall recycling
J. Bacteriol. 182 (17), 4836-4840 (2000)
Medline: 20398166



Comment:
This protein cleaves GLCNAC linked beta-1,4 to murnac tripeptides.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to beta-hexosaminidase protein sequences,e.g. residues 7-346 are 60% similar to a beta-hexosaminidase in Haemophilus influenzae Rd KW20 (1175341|).

Residues 2-349 are 51% similar to a beta-hexosaminidase in Escherichia coli (3025061|).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1472
COG name: Beta-glucosidase-related glycosidases
Functional Class:  G
The phylogenetic pattern of COG1472 is ------VcEbRh----O---x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001764 (Glycoside hydrolase family 3, N terminal) with a combined E-value of 2.7e-18.
    IPB001764A    161-175
    IPB001764B    238-253
    IPB001764C    267-290


ProDom Summary:  Protein Domain Search
Residues 7-283 are 70% similar to a (HYDROLASE GLYCOSIDASE BETA-GLUCOSIDASE PRECURSOR SIGNAL) protein domain (PD001132) which is seen in NAGZ_PASMU.



Paralogs:  Local Blast Search

HD0542 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 55 to 282 (E-value = 2.5e-58) place HD0542 in the Glyco_hydro_3 family which is described as Glycosyl hydrolase family 3 N terminal domain (PF00933)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LLGNIMLIIDIKGTEISQQEIEILSHPLVAGLILFSRNFVDKAQLTALIK
EIRQKVTKPLLITIDQEGGRVQRFREGFTRLPAMQAFGQLAKHPQEAIIW
AKQAGWLMAAEMFALDIDLSFAPVLDLGHKCKAIGDRSFGEKVTQILPIA
EGFIDGMREIGMATTGKHFPGHGQVIADSHLETPFDERAKANIFNYDIQP
FEYFIAKNKLSAIMPAHVVYTQCDPHPASGSTYWLQQVLRQQLQFKGIIF
SDDLGMQGANLMGNFLQRSEQAINAGCDLLLLCNQPEGVIEVLNGLTYQP
NKLEQQKYLTLKKRRTIDFQQLASSPRYQQTKQHLEQLHECWLEWQTTH$


Gene Nucleotide Sequence:  Sequence Viewer
TTGTTAGGAAACATTATGTTAATAATTGACATTAAAGGCACAGAAATAAG
CCAACAAGAAATAGAAATTCTATCACACCCATTAGTCGCTGGCTTAATCT
TATTTAGTCGTAATTTTGTCGATAAAGCACAATTAACAGCACTCATCAAA
GAAATACGCCAAAAAGTAACCAAGCCTTTATTAATCACCATTGACCAAGA
AGGTGGACGTGTGCAACGTTTTCGCGAAGGCTTCACGCGATTGCCTGCGA
TGCAAGCATTCGGGCAACTAGCAAAGCATCCACAAGAAGCCATTATTTGG
GCAAAGCAGGCAGGCTGGTTAATGGCAGCTGAAATGTTTGCATTAGACAT
TGATCTCAGTTTTGCCCCCGTATTAGATCTTGGCCATAAATGTAAAGCGA
TTGGTGATCGTTCATTTGGTGAAAAAGTTACACAAATTTTACCGATTGCT
GAAGGTTTTATTGATGGTATGCGTGAAATAGGAATGGCGACTACAGGTAA
GCATTTTCCTGGCCATGGTCAGGTTATCGCAGATTCGCATTTAGAAACCC
CTTTTGATGAGCGCGCCAAAGCGAATATTTTTAATTATGATATTCAACCT
TTCGAGTATTTTATCGCTAAAAATAAACTGTCTGCTATTATGCCTGCTCA
CGTGGTATATACACAATGTGATCCACACCCCGCTAGCGGTTCTACATACT
GGTTACAACAAGTACTTCGACAACAACTTCAATTTAAAGGGATTATTTTT
TCAGATGACCTTGGTATGCAAGGTGCTAATTTAATGGGCAATTTTCTACA
ACGGAGTGAGCAAGCAATTAACGCAGGGTGTGATTTACTACTACTTTGTA
ATCAACCTGAAGGTGTAATTGAAGTACTGAATGGCTTAACTTATCAACCA
AATAAATTAGAACAACAAAAATACTTAACCTTAAAAAAACGCCGAACCAT
TGATTTTCAACAATTAGCATCATCGCCGCGTTATCAGCAAACCAAACAAC
ATTTAGAACAGTTACACGAGTGCTGGCTTGAATGGCAAACTACACATTAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy