Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR371 IGR374 IGR380 IGR375 IGR378 IGR381 IGR372 IGR377 IGR370 IGR373 IGR379 IGR376 HD0540 trmA, - HD0541 lexA, - HD0545 mutH, - HD0544 nagZ,hexA, - HD0542 HD0534 HD0536 HD0535 HD0539 HD0533 HD0531 HD0530 HD0532 HD0538 HD0540 trmA, - HD0541 lexA, - HD0545 mutH, - HD0544 nagZ,hexA, - HD0542 HD0534 HD0536 HD0535 HD0539 HD0533 HD0531 HD0530 HD0532 HD0538 trmA, - HD0541 lexA, - HD0545 mutH, - HD0544 nagZ,hexA, - HD0542 HD0540 HD0535 HD0539 HD0533 HD0531 HD0530 HD0532 HD0538 HD0536 HD0534
* Calculated from Protein Sequence

Gene ID: HD0538

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
408559

Gene Stop:
411348

Gene Length:
2790

Molecular Weight*:
103784

pI*:
5.70

Net Charge*:
-14.05

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Two significant hits in gapped BLAST to conserved hypothetical protein sequences:residues 220-775 are 27% similar to hypothetical protein of Xylella fastidiosa (11292989|). See also gi22995506.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 220-775 are 30% similar to a (PROTEOME COMPLETE XF0526 XF2115) protein domain (PD361375) which is seen in Q9PFY0_XYLFA.



Paralogs:  Local Blast Search

HD0538 is paralogously related to HD1580 (0.0), HD0154 (0.0), HD0155 (4e-67) and HD0153 (2e-49).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MGGKRKGGAVTVGYRYYWDIHSGLGRGPVDEIVELRIDDKSAYVGKPNEL
THSQAIYIDKPNLFGGENTGGEGGIQGRLEILMGEPDQKPTQMLVNLLKG
NQNPAPAQSNSSRLRKAGQRKKQQAQQDFFKAGELTDAAISKDDMIPGFR
GIVSTVFSGLISCYNAHPKKHSYRLRRNNKGWHGGAVWYPEKCKIMLRND
TLKISGLTKEQEENVRQIHAMNPAHILVECATNKSWGGKKDLSDLDLDSY
KKAADTLYEEGFGLCLRYNRQGSIKEFMQQVIDHIGAVQYDNVETGKQAI
RLLRNDYNPDDLPTFHYDNGILMVQDDDSSATDTTANQIIVKWRDPVTNR
EDQAIANNIASVQMHGVIAKTVEYKGVPTFDLAARLAQRDLEMVASSLTR
LKIVFDMRASELKHGDVFKVHLPERGIESAVFRVSAIENGNEGELIVTCM
QDVFGLPAANYSTRQSESLYIPPDYTAKPIQNSRLFELPYHVYPLVFSEA
ELAFIKPTDCFVWSLASQPSALAVGYDLLTDVGAGFTPVAECSFVPSVTL
SSDITPYQTTVSFVSGDEFADLANAGALMIDDEIVKIESVDFKNSIMTIG
RGCADTIPQAHKQGTTAWCYLLTTSDTDTKYTANEQIKAKLLTRTQIETL
SEDAANVLTLTTQQRQARPYPPANVKVDGVFVDKIADSSAFTLTWAHRDR
DIQADQLISHTEDSTALGKGVSYKIDLMDGNNIVRSITTDSTTFVYPDEG
KIEDEQFSKLVFYTVKDKLTSLYRYEFTVQGAMQLLSDWDYQRAFTQGND
YFNRYDDNDMPTGKYIMLSSSADKESIIYQSFVLEPNKYKRFALSYKIGT
YNQRHGRCRVAVQLYKNDELVKEYLSEQFGGWEESLWHGQQVTEAIAKGV
SEIRFKVNVIGAISNNAIAFKDIVLRAGG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTGGCAAACGTAAAGGCGGTGCGGTAACGGTCGGTTATCGTTACTA
CTGGGATATTCATTCAGGGCTTGGGCGTGGACCAGTGGATGAAATTGTCG
AGTTACGTATTGATGATAAATCAGCCTATGTGGGCAAACCGAATGAGCTA
ACCCACTCACAAGCGATTTATATTGACAAACCAAACTTGTTCGGGGGTGA
AAACACAGGGGGTGAAGGCGGTATTCAAGGGCGGTTAGAGATTCTCATGG
GCGAACCTGATCAAAAGCCGACACAAATGCTAGTTAATCTGTTAAAGGGC
AATCAAAACCCTGCTCCTGCCCAATCGAATAGCTCCCGCTTACGTAAAGC
AGGACAACGCAAAAAACAGCAAGCTCAGCAAGACTTTTTCAAAGCAGGCG
AGCTAACTGATGCTGCTATATCTAAAGATGACATGATCCCTGGTTTTCGC
GGTATTGTCTCGACCGTGTTTAGTGGGCTGATTAGTTGCTATAACGCTCA
CCCGAAAAAACACAGTTATCGCCTACGTCGTAACAATAAAGGTTGGCACG
GCGGTGCGGTATGGTATCCAGAAAAATGCAAAATTATGTTACGCAATGAC
ACGTTAAAAATTTCAGGGCTCACGAAAGAGCAAGAAGAAAATGTGCGCCA
AATCCACGCCATGAACCCTGCACATATTCTGGTTGAGTGTGCGACCAATA
AAAGTTGGGGTGGTAAAAAAGACTTAAGTGATCTTGATTTAGATAGCTAC
AAAAAAGCCGCGGATACACTGTATGAAGAAGGCTTTGGCTTATGCTTGCG
CTACAATCGCCAAGGCTCGATTAAAGAGTTTATGCAACAGGTTATCGACC
ATATTGGGGCTGTGCAGTACGACAACGTGGAAACAGGTAAACAAGCCATT
CGTTTATTGCGTAACGATTACAATCCTGACGATTTGCCCACATTTCACTA
TGATAACGGGATTTTAATGGTGCAAGATGATGACAGTTCGGCAACGGATA
CAACCGCCAATCAAATTATCGTGAAATGGCGCGACCCAGTGACAAACCGT
GAAGACCAAGCTATTGCGAATAATATTGCGTCTGTACAAATGCACGGTGT
TATCGCTAAAACAGTGGAATATAAAGGTGTGCCGACGTTTGACTTAGCAG
CTCGCCTTGCACAGCGTGATTTGGAGATGGTCGCCAGCAGTTTAACTCGT
CTTAAGATTGTGTTTGATATGCGTGCTAGCGAATTGAAACACGGCGATGT
TTTCAAAGTACATTTACCGGAACGTGGCATTGAAAGTGCGGTTTTTCGCG
TCAGTGCCATTGAAAACGGTAACGAGGGTGAGTTGATTGTGACTTGTATG
CAAGATGTGTTCGGTTTACCGGCTGCGAATTACTCAACACGACAATCTGA
GTCGCTTTATATTCCACCGGACTATACCGCAAAACCGATTCAAAATAGCC
GATTATTTGAATTGCCATACCATGTTTACCCTTTAGTCTTTAGCGAAGCG
GAATTGGCATTTATTAAACCAACGGATTGCTTTGTGTGGTCGCTGGCAAG
TCAGCCAAGTGCTTTAGCCGTGGGTTATGATTTACTTACTGATGTAGGGG
CAGGCTTTACACCGGTAGCAGAATGCTCATTTGTACCATCAGTAACACTC
AGTTCAGACATTACGCCGTATCAAACTACAGTGAGTTTTGTTTCCGGAGA
TGAGTTTGCGGATTTAGCGAATGCCGGTGCATTAATGATTGATGACGAGA
TTGTCAAAATTGAGTCGGTCGATTTTAAAAACTCAATAATGACTATCGGT
CGCGGCTGTGCAGATACTATCCCGCAAGCACATAAACAAGGTACTACTGC
ATGGTGTTATTTGCTTACGACATCAGATACTGACACAAAATATACCGCAA
ATGAGCAAATTAAAGCGAAATTACTCACCCGTACACAGATTGAAACGCTT
TCTGAAGATGCGGCTAATGTATTAACACTCACCACACAGCAACGACAAGC
GCGACCTTACCCACCGGCAAATGTAAAAGTAGACGGTGTATTTGTTGATA
AGATTGCAGACAGTTCAGCCTTTACACTTACATGGGCGCATCGCGATAGA
GATATTCAAGCCGACCAGCTTATTTCACATACTGAAGACAGTACTGCACT
AGGGAAAGGTGTCAGCTATAAAATTGATTTAATGGACGGTAATAACATAG
TGCGGTCAATTACAACCGATTCTACAACGTTTGTTTATCCGGACGAGGGC
AAAATCGAGGATGAGCAATTTAGCAAACTGGTGTTCTACACGGTGAAAGA
TAAGCTGACAAGCCTGTATCGCTATGAGTTTACCGTGCAAGGTGCAATGC
AATTATTAAGTGATTGGGATTATCAACGCGCATTTACACAAGGTAATGAT
TACTTCAATCGTTATGATGATAACGATATGCCGACAGGTAAATATATCAT
GCTGTCATCAAGTGCGGATAAAGAGAGCATTATTTATCAATCATTTGTGC
TCGAACCTAATAAATATAAACGCTTTGCCCTCTCTTATAAGATTGGTACC
TACAATCAACGCCATGGACGTTGTAGGGTTGCGGTTCAACTATACAAAAA
TGATGAATTAGTTAAAGAGTACCTTTCAGAACAGTTCGGCGGTTGGGAAG
AAAGTTTATGGCACGGACAACAAGTAACTGAAGCTATCGCTAAAGGCGTG
AGCGAAATCCGATTTAAGGTAAATGTGATCGGGGCAATATCGAATAATGC
GATTGCATTTAAAGATATTGTTTTACGGGCAGGAGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy