Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR369 IGR371 IGR374 IGR375 IGR372 IGR370 IGR373 IGR376 HD0534 HD0536 HD0535 HD0539 HD0533 HD0531 HD0530 HD0532 HD0529 HD0538 HD0527 HD0534 HD0536 HD0535 HD0539 HD0533 HD0531 HD0530 HD0532 HD0529 HD0538 HD0527 HD0535 HD0539 HD0533 HD0531 HD0530 HD0532 HD0529 HD0538 HD0527 HD0536 HD0534
* Calculated from Protein Sequence

Gene ID: HD0532

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
406235

Gene Stop:
407221

Gene Length:
987

Molecular Weight*:
37291

pI*:
7.10

Net Charge*:
0.57

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
One significant hit in gapped BLAST to hypothetical protein:
residues 1-326 are 30% similar to a hypothetical protein in Xylella fastidiosa (11346120|). See also gi 15837124.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-326 are 30% similar to a (PROTEOME COMPLETE XF0522) protein domain (PD322297) which is seen in Q9PFY4_XYLFA.



Paralogs:  Local Blast Search
HD0532 is paralogously related to HD1574 (0.0) and HD0148 (1e-123).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLYAYGARVWALPIFTHQVYLDKPTKPGDKTLSLATTGFDFYVGGRAVLM
NGNKREMVDITGIEPDKLEIKRSLLNRFDTSTVVYPLRSAVLTDMPQLTR
LSDEVATAQIRLQIHEHNGYAADIRHLPTYRGHPVLEPTSEWSEDITAQY
LRLIKQLDNGTALPHYLDTAKNAFQLTNHRFLLDSIEAQHKLRQLFYYLR
GRQKAIWVASSTSDLTLANDIVGKNLDIELVYYTTCLLKQAGRQDIRIEC
TDGSVHYRRILAATVSNNQTERLALDGEALNLKREQVAKISFLTLSRLES
DTIDWVHHTDTVASVTVSFRGLRDELEV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCTACGCTTACGGTGCAAGGGTGTGGGCATTGCCAATTTTTACTCA
TCAAGTCTATTTAGACAAGCCAACTAAACCAGGCGATAAAACGTTATCAC
TTGCCACCACGGGCTTTGACTTTTATGTCGGTGGGCGTGCGGTTTTGATG
AACGGGAACAAACGTGAAATGGTGGATATTACCGGCATTGAGCCTGATAA
GCTTGAAATAAAACGTTCGTTACTGAATCGCTTTGATACCAGCACCGTGG
TTTATCCGCTACGCTCCGCCGTGCTGACCGATATGCCACAACTTACTCGT
TTAAGTGATGAGGTGGCAACCGCACAAATTCGCCTGCAAATTCACGAGCA
CAATGGCTATGCCGCTGATATTCGTCACTTGCCGACTTATCGCGGACATC
CGGTTTTAGAGCCAACCAGCGAATGGTCGGAAGATATTACCGCACAATAC
TTACGTTTGATTAAACAACTGGATAACGGCACGGCATTACCGCATTACTT
AGATACGGCTAAAAATGCGTTTCAGCTGACAAACCATCGTTTCTTACTCG
ATAGTATTGAAGCACAACACAAACTGCGCCAGCTTTTTTATTACTTACGC
GGCAGACAAAAAGCGATTTGGGTAGCAAGTTCGACATCAGATTTAACACT
AGCAAACGATATTGTCGGCAAAAATCTCGATATTGAGCTGGTTTATTACA
CGACTTGCTTATTGAAACAAGCGGGACGGCAAGACATTCGCATTGAGTGT
ACCGACGGCAGCGTGCATTACCGCCGGATTTTAGCCGCAACGGTAAGCAA
CAACCAAACCGAACGGCTTGCGCTGGATGGTGAAGCGTTAAATTTAAAGC
GTGAACAAGTGGCTAAGATTTCTTTTCTGACACTCTCACGCTTAGAGAGC
GACACGATTGACTGGGTACATCATACCGACACCGTAGCAAGTGTGACGGT
TAGTTTCCGAGGGTTGCGTGATGAACTCGAAGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy