Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR365 IGR361 IGR366 IGR362 IGR364 IGR367 IGR368 IGR363 HD0516 HD0526 HD0520 HD0517 HD0525 HD0522 HD0523 HD0519 HD0529 HD0518 HD0527 HD0516 HD0526 HD0520 HD0517 HD0525 HD0522 HD0523 HD0519 HD0529 HD0518 HD0527 HD0516 HD0526 HD0517 HD0525 HD0523 HD0519 HD0529 HD0518 HD0527 HD0521 HD0520 HD0522 HD0521
* Calculated from Protein Sequence

Gene ID: HD0525

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
399350

Gene Stop:
399769

Gene Length:
420

Molecular Weight*:
15696

pI*:
4.70

Net Charge*:
-6.28

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-115 are 33% similar to gi 15837121 of X.fastidiosa. No other matches in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0525 is paralogously related to HD1567 (3e-77) and HD0137 (5e-38).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQKNDELNVLFPNEKITIAGEEIEVKEYSLIQQLQHRALFMPFVTALRGT
LSKAEAEFGLDGLMNLIAEHYQDVLHLVSISVGKPLEWVQNLTGEDAETV
LMMWWTVNSDFFTRQAVQPMLEKMAQANLKSVGVKSSSN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAAAAATGATGAATTAAATGTGTTGTTCCCGAATGAGAAAATCAC
TATTGCGGGCGAAGAAATCGAAGTCAAAGAATACTCTTTAATCCAACAAT
TACAGCACCGTGCGTTGTTTATGCCATTTGTTACGGCATTGCGTGGCACG
TTAAGTAAAGCTGAAGCGGAGTTTGGTTTAGATGGTTTGATGAACCTTAT
TGCCGAACATTACCAAGATGTACTGCATTTAGTCAGTATTTCGGTGGGTA
AACCACTTGAATGGGTACAGAATCTGACAGGCGAAGATGCCGAAACGGTG
TTAATGATGTGGTGGACGGTAAATAGCGATTTTTTTACCCGTCAGGCGGT
ACAGCCGATGTTAGAGAAAATGGCGCAGGCGAACCTGAAATCTGTTGGGG
TGAAATCGTCGAGCAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy