Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR365 IGR361 IGR366 IGR362 IGR364 IGR367 IGR368 IGR363 HD0516 HD0526 HD0520 HD0517 HD0525 HD0522 HD0523 HD0519 HD0518 HD0515 HD0527 HD0516 HD0526 HD0520 HD0517 HD0525 HD0522 HD0523 HD0519 HD0518 HD0515 HD0527 HD0516 HD0526 HD0517 HD0525 HD0523 HD0519 HD0518 HD0515 HD0527 HD0521 HD0520 HD0522 HD0521
* Calculated from Protein Sequence

Gene ID: HD0522

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
398073

Gene Stop:
398519

Gene Length:
447

Molecular Weight*:
16406

pI*:
10.10

Net Charge*:
4.23

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 2-140 are 27% similar to >24372269 hypothetical protein [Shewanella oneidensis MR-1]. No other matches in gapped BLAST at this time.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0522 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNYLFAGEAIKQRLKSAVPEFKEILLAGELAKISQAAQKSPSAYVIYDGD
VINASVQAHGTLSKTQYITQRWTVAIVVNLADKRSLNSADDVAGQLMTKT
LQALSGFVINERTKPLTRAPVSRKVDYIDGWGYYPYVFNIDFIMPKST$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACTATTTATTTGCAGGTGAGGCGATTAAACAGCGACTGAAAAGCGC
TGTGCCTGAATTTAAAGAGATCTTACTTGCTGGCGAGTTGGCTAAAATCA
GCCAAGCAGCGCAAAAATCTCCGAGTGCTTATGTGATATATGACGGTGAT
GTGATTAATGCATCGGTGCAGGCCCATGGCACATTAAGTAAGACACAATA
TATCACGCAAAGATGGACGGTCGCGATAGTCGTTAATCTTGCAGATAAAC
GTAGTTTAAATAGTGCGGATGACGTTGCAGGTCAGTTGATGACAAAAACA
TTACAAGCATTAAGTGGTTTTGTCATCAATGAAAGAACTAAGCCGCTTAC
ACGTGCACCTGTGTCACGTAAAGTGGACTATATCGACGGGTGGGGTTACT
ACCCTTACGTCTTTAACATCGACTTTATTATGCCGAAATCAACATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy