Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR357 IGR359 IGR360 IGR354 IGR361 IGR362 IGR358 IGR355 IGR363 IGR353 HD0516 HD0510 HD0499 HD0506 HD0517 HD0502 HD0504 HD0500 HD0497 HD0509 HD0498 HD0501 HD0512 HD0514 HD0516 HD0510 HD0499 HD0506 HD0517 HD0502 HD0504 HD0500 HD0497 HD0509 HD0498 HD0501 HD0512 HD0514 HD0516 HD0517 HD0498 HD0501 HD0512 HD0514 HD0503 HD0507 HD0511 HD0515 HD0511 HD0515 HD0504 HD0509 HD0502 HD0500 HD0497 HD0510 HD0506 HD0503 HD0499 HD0507
* Calculated from Protein Sequence

Gene ID: HD0511

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
389959

Gene Stop:
390729

Gene Length:
771

Molecular Weight*:
29297

pI*:
8.00

Net Charge*:
2.32

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Three significant hits in gapped BLAST to hypothetical protein sequences found in Neisseria meningitidis,e.g.residues 10-251 are 53% similar to hypothetical protein in Neisseria meningitidis
group A strain Z2491 (7379989|).


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 35-251 are 55% similar to a (PROTEOME COMPLETE NMA1313 NMA1852) protein domain (PD340505) which is seen in Q9JZE3_NEIMB.



Paralogs:  Local Blast Search
HD0511 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LPLCYWIKRMKIKEFEKELEALRIDLQRNIEANFEGWDDQAESILRRRKQ
ALNPITGFEFFVQNYFPHYVRSEHKSQLHEYLFENLPASVNVGELSKSVR
QAIAAPRGEAKSTICTQLFPLWCMVADLKKYIIIAMDTKEQAYGMLEAIK
VEIESNPRLHIDFPELSAGKVWRAGAILTSKNQKVEAVGAGQKLRGRRHG
AYRPDLVVLDDIENDESVQTPEQRNKLHAWILKAVLKLGAAGEKFDVIYV
GDNSTL$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCCGCTTTGTTACTGGATTAAACGAATGAAAATTAAAGAATTTGAAAA
AGAACTGGAAGCCCTACGCATTGATTTGCAGCGTAACATTGAAGCAAATT
TTGAGGGGTGGGATGACCAGGCTGAGTCTATTTTAAGACGTCGCAAACAG
GCACTAAATCCTATCACAGGCTTTGAGTTTTTTGTGCAAAATTATTTTCC
GCATTATGTGCGCTCAGAGCACAAATCTCAATTGCACGAATACCTTTTCG
AGAATTTGCCGGCTTCAGTCAATGTTGGCGAATTAAGTAAATCTGTTCGA
CAGGCAATTGCTGCACCTCGCGGTGAGGCAAAATCAACCATTTGTACTCA
GCTTTTCCCACTGTGGTGTATGGTAGCTGATCTAAAAAAATACATCATTA
TTGCAATGGATACGAAAGAGCAAGCCTACGGTATGCTCGAAGCGATTAAA
GTCGAAATCGAAAGCAACCCACGCCTCCATATTGATTTCCCCGAGTTGAG
TGCGGGTAAGGTGTGGCGTGCAGGGGCTATTTTAACTAGCAAAAATCAGA
AAGTAGAAGCAGTCGGTGCGGGACAAAAATTGCGTGGACGTCGTCACGGC
GCATACCGTCCAGACTTGGTGGTGTTGGACGATATTGAGAATGATGAATC
AGTACAAACGCCCGAGCAGCGAAATAAACTACACGCTTGGATTTTAAAAG
CCGTACTCAAACTTGGTGCTGCAGGCGAGAAATTCGACGTGATTTATGTG
GGGGACAATTCTACATTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy