Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR357 IGR359 IGR360 IGR354 IGR361 IGR358 IGR355 IGR353 HD0516 HD0510 HD0499 HD0506 HD0502 HD0504 HD0500 HD0509 HD0496 HD0498 HD0501 HD0512 HD0514 HD0516 HD0510 HD0499 HD0506 HD0502 HD0504 HD0500 HD0509 HD0496 HD0498 HD0501 HD0512 HD0514 HD0516 HD0498 HD0501 HD0512 HD0514 HD0503 HD0507 HD0497 HD0511 HD0515 HD0511 HD0515 HD0504 HD0509 HD0496 HD0500 HD0497 HD0510 HD0506 HD0502 HD0499 HD0503 HD0507
* Calculated from Protein Sequence

Gene ID: HD0509

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein (possible DNA-binding protein)

Gene Start:
389386

Gene Stop:
389886

Gene Length:
501

Molecular Weight*:
18316

pI*:
6.80

Net Charge*:
-0.27

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Only three significant hits in gapped BLAST to a putative DNA-binding protein sequence found only in Neisseria meningitidis, e.g.residues 1-166 are 34% similar to a probable DNA-binding protein NMA1312 in Neisseria meningitidis group A strain Z2491 (7379988|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-165 are 37% similar to a (DNA-BINDING PROTEOME COMPLETE) protein domain (PD339326) which is seen in Q9JQU4_NEIME.



Paralogs:  Local Blast Search

HD0509 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAHDVEVKNAVRGAYVFDRLSLEMAAEKAGVSFGTARRWKANAESNGDNW
DKARDVHVMASGGIENIAQGLLTGFLIKYRKLMSELEENTEMATAAKVEA
LSALADSFAKMTASSKKLLPETSAMATAMRAIEMMANIVKSKKPHLLPDF
LEMLDDLEVQFKKEFK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACACGATGTTGAAGTAAAAAATGCTGTGCGCGGTGCTTATGTGTT
TGACCGTTTAAGTCTTGAAATGGCAGCAGAAAAGGCAGGTGTGTCTTTTG
GTACAGCACGTCGCTGGAAAGCAAACGCAGAAAGTAATGGCGATAACTGG
GATAAAGCCCGAGATGTACACGTAATGGCAAGCGGTGGCATTGAGAATAT
TGCTCAAGGCTTACTAACAGGCTTTTTAATCAAATACCGCAAGTTAATGA
GCGAGCTTGAAGAAAATACCGAAATGGCAACTGCGGCAAAAGTAGAAGCA
CTTTCTGCGCTCGCCGACTCTTTTGCCAAAATGACAGCATCAAGCAAAAA
ATTGCTACCCGAAACGAGTGCAATGGCAACGGCTATGCGTGCAATTGAAA
TGATGGCAAATATTGTTAAAAGTAAAAAACCACACTTATTACCAGACTTT
TTAGAAATGTTAGACGACCTCGAAGTGCAATTTAAAAAGGAGTTTAAATA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy