Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR349 IGR357 IGR359 IGR360 IGR347 IGR354 IGR346 IGR350 IGR352 IGR358 IGR348 IGR355 IGR353 HD0510 HD0492 HD0499 HD0490 HD0506 HD0495 HD0493 HD0488 HD0502 HD0504 tpn, - HD0485 HD0500 HD0509 HD0496 HD0498 HD0489 HD0501 HD0512 HD0514 HD0510 HD0492 HD0499 HD0490 HD0506 HD0495 HD0493 HD0488 HD0502 HD0504 tpn, - HD0485 HD0500 HD0509 HD0496 HD0498 HD0489 HD0501 HD0512 HD0514 HD0498 HD0489 HD0501 HD0514 HD0494 HD0486 HD0503 HD0507 HD0497 HD0511 HD0511 HD0493 HD0504 tpn, - HD0485 HD0509 HD0496 HD0502 HD0500 HD0512 HD0497 HD0510 HD0490 HD0506 HD0495 HD0488 HD0503 HD0499 HD0486 HD0507 HD0492 HD0494
* Calculated from Protein Sequence

Gene ID: HD0500

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
386769

Gene Stop:
387197

Gene Length:
429

Molecular Weight*:
16747

pI*:
8.90

Net Charge*:
4.04

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Two significant hits using gapped BLAST to hypothetical proteins sequences,e.g.residues 3-132 are 40% similar to a hypothetical protein sequence in Neisseria meningitidis MC58 (7226225|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 3-132 are 40% similar to a (COMPLETE PROTEOME B NMA1302) protein domain (PD332485) which is seen in Q9JZM5_NEIMB.



Paralogs:  Local Blast Search
HD0500 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VAMQFENVQDYLPECVQTIVDVIGLPATEKLVRAFGGFSFQFSRSKTYFD
RLRDILGQEDAVKLQQFMDRSEVYIPRCEVALRMLRNQKLYADFCYLTQH
ERLSGRLAILQLCQKYQVSDRTAWDVVRAFQRQRNYTKATLF$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCTATGCAATTTGAAAATGTACAAGACTATTTGCCTGAGTGTGTGCA
AACGATTGTGGACGTGATTGGACTCCCTGCAACCGAAAAACTGGTGCGGG
CGTTTGGTGGCTTTTCGTTTCAGTTTTCACGCTCAAAAACCTATTTTGAC
CGTTTGCGTGATATACTCGGTCAAGAAGATGCGGTCAAATTGCAGCAGTT
TATGGACAGAAGCGAGGTATATATCCCTCGCTGTGAGGTGGCATTACGAA
TGTTACGCAATCAGAAATTGTATGCCGATTTTTGCTATTTAACTCAACAT
GAACGTTTAAGTGGGCGACTTGCTATTTTGCAACTTTGTCAAAAATATCA
AGTATCTGATCGCACGGCATGGGATGTGGTGCGTGCTTTTCAGCGCCAGA
GAAATTACACTAAAGCCACACTGTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy