Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR349 IGR357 IGR347 IGR354 IGR346 IGR342 IGR345 IGR350 IGR352 IGR344 IGR348 IGR341 IGR343 IGR355 IGR353 HD0483 HD0479 HD0492 HD0499 HD0490 HD0480 HD0495 HD0493 HD0488 HD0502 tpn, - HD0485 HD0500 tpn, - HD0484 HD0496 HD0498 HD0489 HD0501 tpn, - HD0482 tpn, - HD0481 HD0483 HD0479 HD0492 HD0499 HD0490 HD0480 HD0495 HD0493 HD0488 HD0502 tpn, - HD0485 HD0500 tpn, - HD0484 HD0496 HD0498 HD0489 HD0501 tpn, - HD0482 tpn, - HD0481 HD0483 HD0479 HD0480 tpn, - HD0485 tpn, - HD0484 HD0498 HD0489 HD0501 tpn, - HD0482 tpn, - HD0481 HD0494 HD0486 HD0497 HD0493 HD0496 HD0488 HD0502 HD0500 HD0497 HD0490 HD0495 HD0486 HD0499 HD0492 HD0494
* Calculated from Protein Sequence

Gene ID: HD0489

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
382581

Gene Stop:
383198

Gene Length:
618

Molecular Weight*:
22955

pI*:
6.20

Net Charge*:
-2.08

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 11 to 203 are 54% ( EScore : 3e-56 ) identical to emb|CAB71969.1| (AJ391256) hypothetical protein [Neisseria meningitidis] >7380508|emb|CAB85094.1| between residues 9 and 201 in [Neisseria meningitidis]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 11-203 are 54% similar to a (PROTEOME COMPLETE NMA1871) protein domain (PD310533) which is seen in Q9JRE4_NEIME.



Paralogs:  Local Blast Search
HD0489 is paralogously related to HD0097 (1e-61).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSKVEIGGEIYWKDPNGNLKPDALVKEIDKERDGLVREFAQKAKSHSAML
SQFKRQVFDDVGAFVGLSAEKYGVKIGGAKGNVSLFTYDGQFKMQLAVQD
HIRFDERIHAAKALIDTCLHDWSEGAKPELKTLIDNAFEVDKEGNLSTAK
ILSLRRVEIDDKRWNQAMEAISDSVQVVGSKDYVRFYERNQDGKYVPIAL
DVAGA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAAAGTAGAAATTGGTGGCGAAATTTACTGGAAAGACCCTAACGG
CAACTTAAAACCTGATGCGCTAGTAAAAGAAATTGATAAAGAGCGTGACG
GGCTAGTCCGTGAGTTTGCACAAAAAGCGAAATCGCATAGCGCTATGCTT
AGCCAATTTAAGCGCCAAGTGTTTGATGATGTAGGTGCATTTGTGGGGTT
ATCCGCCGAGAAATACGGCGTAAAAATTGGTGGCGCAAAAGGTAACGTGA
GCCTATTTACTTACGACGGTCAGTTTAAGATGCAATTAGCTGTGCAAGAC
CACATCCGCTTTGATGAGCGCATCCATGCGGCTAAAGCATTGATTGATAC
CTGTTTGCACGATTGGTCCGAAGGGGCTAAGCCCGAATTAAAAACTTTAA
TCGACAATGCTTTTGAGGTGGACAAGGAAGGGAATTTATCAACAGCAAAA
ATCCTCTCTTTGCGCCGTGTAGAGATTGACGACAAACGTTGGAATCAAGC
AATGGAAGCGATTAGCGATAGCGTGCAAGTGGTTGGCAGTAAAGATTACG
TGCGATTTTATGAACGAAATCAAGACGGAAAATATGTGCCAATTGCATTA
GATGTCGCGGGGGCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy