Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR349 IGR347 IGR346 IGR342 IGR345 IGR350 IGR352 IGR344 IGR348 IGR341 IGR343 IGR339 IGR340 HD0483 trmA, - HD0478 HD0479 eno, - HD0477 HD0492 HD0490 HD0480 HD0495 HD0493 HD0488 tpn, - HD0485 tpn, - HD0484 HD0496 HD0489 tpn, - HD0482 tpn, - HD0481 HD0483 trmA, - HD0478 HD0479 eno, - HD0477 HD0492 HD0490 HD0480 HD0495 HD0493 HD0488 tpn, - HD0485 tpn, - HD0484 HD0496 HD0489 tpn, - HD0482 tpn, - HD0481 HD0483 trmA, - HD0478 HD0479 eno, - HD0477 HD0480 tpn, - HD0485 tpn, - HD0484 HD0489 tpn, - HD0482 tpn, - HD0481 HD0494 HD0486 HD0497 HD0493 HD0496 HD0488 HD0497 HD0490 HD0495 HD0486 HD0492 HD0494
* Calculated from Protein Sequence

Gene ID: HD0482

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tpn  

Definition:
phage transposase

Gene Start:
380017

Gene Stop:
380874

Gene Length:
858

Molecular Weight*:
32813

pI*:
10.40

Net Charge*:
10.90

EC:
 

Functional Class:
Other categories; Transposase  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1 to 249 are 39% ( EScore : 1e-45 ) identical to emb|CAB71961.1| (AJ391256) putative transposase [Neisseria meningitidis] >7380519|emb|CAB85105.1| between residues 386 and 642 in [Neisseria meningitidis]
Residues 2 to 209 are 41% ( EScore : 8e-35 ) identical to gb|AAF41473.1| (AE002458) bacteriophage transposase between residues 380 and 592 in [Neisseria meningitidis MC58]
Residues 1 to 209 are 41% ( EScore : 2e-34 ) identical to emb|CAB84536.1| (AL162755) putative phage transposase between residues 375 and 588 in [Neisseria meningitidis]
Residues 1 to 276 are 29% ( EScore : 5e-28 ) identical to pir||S62728 transposase - phage D3112 >974769|emb|CAA60956.1| between residues 351 and 623 in [Bacteriophage D3112]
Residues 161 to 249 are 34% ( EScore : 3e-08 ) identical to gb|AAC44489.1| (U56765) transposase homolog between residues 1 and 88 in [Neisseria meningitidis]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-249 are 39% similar to a (TRANSPOSASE PROTEOME COMPLETE PHAGE) protein domain (PD332924) which is seen in Q9JRG9_NEIME.



Paralogs:  Local Blast Search
HD0482 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MGIKHPTGIPGNPQGRGIIERVNKTIALRIARQFSTYHGTGADRETVRQV
STGVISLEKAQRQGKADTELTVKQKSAKGKLPSWQEFIQAVENGINWYNN
EHVHREIGTTPARKRAELLENTEILHVSPVEARDMFRPQVIRTAQRGWLS
LFNNNYFNQKLIEVDGEKVTVSFDIHNADSVIVRHLDGRYICNAQFDGNK
RDVFPQAYVEKSREERGKRREKLRQEQLDEIRAERNPVRTIEHQKMPEFS
FVTTTKAKQAKQINYAFTQAEKDEMDRKLIAASFE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCATTAAGCACCCGACAGGGATACCAGGTAATCCTCAAGGGCGAGG
CATTATTGAACGTGTGAATAAAACGATCGCATTACGTATTGCGAGACAAT
TTTCCACCTATCACGGCACAGGAGCCGATAGAGAAACCGTTCGCCAAGTT
TCGACAGGTGTGATCAGCTTAGAAAAAGCGCAACGCCAAGGCAAAGCAGA
TACAGAACTCACCGTAAAACAAAAATCTGCAAAAGGTAAATTGCCAAGTT
GGCAAGAATTTATCCAAGCAGTAGAAAACGGCATTAATTGGTACAACAAC
GAACACGTACATAGAGAAATTGGCACAACGCCTGCTCGCAAACGTGCAGA
GTTACTCGAAAACACAGAAATTTTACACGTGAGCCCTGTTGAAGCACGGG
ATATGTTTAGACCACAAGTTATTCGTACCGCACAGCGAGGTTGGTTATCG
TTATTTAACAATAATTACTTTAATCAGAAATTGATTGAAGTTGATGGCGA
AAAAGTCACCGTGAGTTTTGATATTCACAACGCCGACAGTGTGATTGTGC
GCCATTTGGACGGTAGATATATCTGCAACGCACAATTTGACGGCAACAAG
CGTGACGTATTCCCGCAAGCGTATGTTGAAAAATCTCGAGAAGAACGTGG
TAAACGCCGTGAGAAATTAAGACAGGAGCAATTGGATGAAATCCGTGCAG
AACGTAACCCTGTAAGAACGATTGAACACCAAAAAATGCCTGAATTTAGC
TTTGTTACAACAACAAAAGCCAAGCAGGCAAAACAAATAAATTACGCCTT
TACTCAAGCAGAGAAAGACGAGATGGATAGGAAATTAATCGCTGCTAGTT
TTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy