Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR349 IGR347 IGR346 IGR342 IGR345 IGR350 IGR344 IGR348 IGR338 IGR341 IGR343 IGR339 IGR340 HD0483 trmA, - HD0478 HD0479 eno, - HD0477 HD0492 HD0490 HD0480 HD0493 HD0488 tpn, - HD0485 tpn, - HD0484 HD0489 tpn, - HD0482 tpn, - HD0481 recQ, - HD0475 HD0483 trmA, - HD0478 HD0479 eno, - HD0477 HD0492 HD0490 HD0480 HD0493 HD0488 tpn, - HD0485 tpn, - HD0484 HD0489 tpn, - HD0482 tpn, - HD0481 recQ, - HD0475 HD0483 trmA, - HD0478 HD0479 eno, - HD0477 HD0480 tpn, - HD0485 tpn, - HD0484 HD0489 tpn, - HD0482 tpn, - HD0481 recQ, - HD0475 HD0486 HD0493 HD0488 HD0486 HD0490 HD0492
* Calculated from Protein Sequence

Gene ID: HD0480

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
378622

Gene Stop:
378885

Gene Length:
264

Molecular Weight*:
9857

pI*:
10.90

Net Charge*:
7.70

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1 to 81 are 37% ( EScore : 2e-09 ) identical to emb|CAB84535.1| (AL162755) hypothetical protein NMA1283 between residues 1 and 77 in [Neisseria meningitidis]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-81 are 37% similar to a (PROTEOME COMPLETE NMA1283) protein domain (PD276083) which is seen in Q9JUJ6_NEIMA.



Paralogs:  Local Blast Search
HD0480 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNQQEIYQALKNKNLNASIIAEALGVSSQAVSNAIKQGKSSERIAKAIAI
AIEQPLEKVFPHYAHKHQQRVFRKKQVRELQSQFSQM$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCAACAGGAAATTTATCAAGCATTAAAAAACAAAAATTTGAATGC
TTCTATTATTGCAGAAGCTCTCGGAGTAAGTTCACAAGCGGTTTCTAACG
CAATAAAACAAGGAAAAAGTAGTGAGCGAATTGCAAAAGCGATTGCAATT
GCTATTGAACAACCTTTAGAAAAAGTCTTCCCTCACTACGCTCACAAACA
CCAGCAGAGAGTATTTAGGAAAAAACAAGTACGTGAATTACAGAGTCAAT
TTTCACAAATGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy