Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR347 IGR346 IGR342 IGR345 IGR337 IGR344 IGR338 IGR341 IGR343 IGR339 IGR340 HD0483 trmA, - HD0478 HD0479 eno, - HD0477 HD0480 cyaY, - HD0473 HD0488 tpn, - HD0485 tpn, - HD0484 HD0489 tpn, - HD0482 tpn, - HD0481 recQ, - HD0475 HD0483 trmA, - HD0478 HD0479 eno, - HD0477 HD0480 cyaY, - HD0473 HD0488 tpn, - HD0485 tpn, - HD0484 HD0489 tpn, - HD0482 tpn, - HD0481 recQ, - HD0475 HD0483 trmA, - HD0478 HD0479 eno, - HD0477 HD0480 cyaY, - HD0473 tpn, - HD0485 tpn, - HD0484 HD0489 tpn, - HD0482 tpn, - HD0481 recQ, - HD0475 HD0486 HD0488 HD0486
* Calculated from Protein Sequence

Gene ID: HD0479

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein (possible DNA-binding protein)

Gene Start:
378543

Gene Stop:
377701

Gene Length:
843

Molecular Weight*:
31707

pI*:
10.50

Net Charge*:
13.93

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
A single significant hit to Neisseria meningitidis:

Residues 5 to 277 are 42% ( EScore : 9e-57 ) identical to HREF="http://www.ncbi.nlm.nih.gov:80/entrez/query.fcgi?cmd=Retrieve&db=Protein&list_uids=7379958&dopt=GenBank" target="_blank">emb|CAB84534.1| (AL162755) putative DNA-binding protein between residues 9 and 292 in [Neisseria meningitidis]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 5-277 are 42% similar to a (DNA-BINDING PROTEOME COMPLETE) protein domain (PD318230) which is seen in Q9JUJ7_NEIMA.



Paralogs:  Local Blast Search
HD0479 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LARQIIFAFYLGFFMELAITREDMGIRLIEERTRLGYSQANFAHQTDISR
EALRLNELGRSGISAEFLGRAAQLGVDVQYVITGVRAQLDNTSTPTQQNV
EGSNNNVIYGEKGIINSGTINNITTEKYTTKTKAVVSPDERHISEETARR
LQDLVKEIVELEQKVKAKPKTFQAVWASLNKHCGVTTYRLIPIENAEKAV
SYLRKWIGRLSSSKSAPKKVGNEWRSKKYAYIKINTKGLESWLKEHLQTK
YSVGSITELSDDQLDKVYRSVSNKKRQASK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGCACGTCAAATAATTTTTGCATTTTATTTGGGATTTTTTATGGAACT
CGCAATAACACGAGAAGATATGGGGATTCGCCTCATAGAAGAAAGAACAA
GATTGGGATACTCTCAAGCTAATTTTGCTCATCAAACAGACATTAGCCGC
GAAGCATTAAGACTGAACGAATTAGGCAGAAGTGGAATTTCGGCAGAATT
TTTGGGAAGAGCTGCACAATTGGGGGTCGATGTTCAATACGTGATTACTG
GTGTTCGAGCTCAATTAGATAATACCTCCACACCTACACAACAAAATGTA
GAAGGCTCTAATAACAATGTTATTTATGGGGAAAAAGGGATAATCAATAG
CGGAACAATTAATAATATCACTACTGAAAAATACACAACGAAAACTAAAG
CTGTTGTTAGTCCTGATGAAAGACACATTAGTGAAGAAACTGCAAGAAGA
CTGCAAGACTTAGTAAAAGAAATAGTTGAATTAGAACAAAAAGTGAAAGC
AAAGCCAAAAACATTCCAAGCTGTTTGGGCTTCCTTAAACAAACATTGTG
GTGTTACGACTTATCGCTTGATCCCTATTGAAAATGCAGAGAAAGCTGTT
AGCTACTTAAGAAAGTGGATTGGGCGTTTATCATCTTCTAAATCAGCCCC
GAAAAAAGTGGGTAATGAGTGGCGTTCTAAAAAATATGCTTACATAAAAA
TCAATACAAAAGGTCTGGAATCTTGGCTTAAAGAACACCTACAAACGAAA
TATTCTGTGGGAAGCATCACTGAGTTAAGCGATGATCAACTAGACAAAGT
TTATCGTTCTGTGAGCAATAAGAAGCGTCAAGCGTCCAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy