Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR342 IGR345 IGR335 IGR337 IGR344 IGR336 IGR338 IGR341 IGR343 IGR339 IGR340 HD0483 trmA, - HD0478 HD0479 eno, - HD0477 HD0480 cyaY, - HD0473 tpn, - HD0485 tpn, - HD0484 lgtB, - HD0472 tpn, - HD0482 tpn, - HD0481 gcp, - HD0471 recQ, - HD0475 HD0483 trmA, - HD0478 HD0479 eno, - HD0477 HD0480 cyaY, - HD0473 tpn, - HD0485 tpn, - HD0484 lgtB, - HD0472 tpn, - HD0482 tpn, - HD0481 gcp, - HD0471 recQ, - HD0475 HD0483 trmA, - HD0478 HD0479 eno, - HD0477 HD0480 cyaY, - HD0473 tpn, - HD0485 tpn, - HD0484 tpn, - HD0482 tpn, - HD0481 gcp, - HD0471 recQ, - HD0475 lgtB, - HD0472
* Calculated from Protein Sequence

Gene ID: HD0478

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
trmA  

Definition:
RNA methyltransferase (trmA family)

Gene Start:
377285

Gene Stop:
376644

Gene Length:
642

Molecular Weight*:
24098

pI*:
10.00

Net Charge*:
7.53

EC:
2.1.1.-  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Porphyrin and chlorophyll metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Urbonavicius J, Durand JM, Bjork GR.
Three modifications in the D and T arms of tRNA influence translation in Escherichia coli and expression of virulence genes in Shigella flexneri.
J Bacteriol. 2002 Oct;184(19):5348-57.
PMID: 12218021

Frees D, Varmanen P, Ingmer H.
Inactivation of a gene that is highly conserved in Gram-positive bacteria stimulates degradation of non-native proteins and
concomitantly increases stress tolerance in Lactococcus lactis.
Mol Microbiol. 2001 Jul;41(1):93-103.
PMID: 11454203

Comment:


Blast Summary:  PSI-Blast Search
Residues 6 to 213 are 55% ( EScore : 4e-58 ) identical to sp|P44083|YBJF_HAEIN HYPOTHETICAL RNA METHYLTRANSFERASE HI0958 >1074579|pir||B64017 probable RNA methyltransferase HI0958 between residues 192 and 389 in [Haemophilus influenzae Rd]
Residues 32 to 213 are 52% ( EScore : 9e-51 ) identical to sp|P75817|YBJF_ECOLI HYPOTHETICAL RNA METHYLTRANSFERASE IN POTI-ARTJ INTERGENIC REGION >7466849|pir||C64824 probable RNA methyltransferase ybjF >1787083|gb|AAC73946.1| between residues 201 and 375 in [Escherichia coli]
Residues 32 to 213 are 48% ( EScore : 2e-46 ) identical to gb|AAF96826.1| (AE004420) TrmA family RNA methyltransferase, putative between residues 201 and 375 in [Vibrio cholerae]
Residues 38 to 213 are 27% ( EScore : 4e-14 ) identical to gb|AAF95594.1| (AE004315) TrmA family RNA methyltransferase, putative between residues 267 and 439 in [Vibrio cholerae]
Residues 36 to 212 are 27% ( EScore : 6e-14 ) identical to pir||H71476 between residues 256 and 428
Residues 36 to 212 are 27% ( EScore : 6e-14 ) identical to sp|P55137|Y742_CHLTR HYPOTHETICAL RNA METHYLTRANSFERASE CT742 between residues 222 and 394 in [Chlamydia trachomatis]
Residues 32 to 212 are 28% ( EScore : 7e-14 ) identical to sp|P55136|YGCA_VIBSS HYPOTHETICAL RNA METHYLTRANSFERASE IN RELA 5-primeREGION between residues 32 and 209 in [Vibrio sp.]
Residues 32 to 211 are 30% ( EScore : 2e-13 ) identical to pir||H75085 probable RNA methyltransferase PAB0719 - Pyrococcus abyssi between residues 241 and 405 in [Pyrococcus abyssi]
Residues 36 to 212 are 26% ( EScore : 2e-13 ) identical to gb|AAA91052.1| (M94254) pCTHom1 gene product between residues 159 and 331 in [Chlamydia trachomatis]
Residues 39 to 213 are 26% ( EScore : 3e-13 ) identical to pir||F69806 RNA methyltransferase homolog yfjO - Bacillus subtilis >2633126|emb|CAB12631.1| between residues 292 and 463 in [Bacillus subtilis]

COGS Summary:  COGS Search
BeTs to 8 clades of COG2265
COG name: SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase
Functional Class: J
The phylogenetic pattern of COG2265 is aMtKYqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB001566 (RNA methyltransferase trmA family) with a combined E-value of 3.8e-32.
    IPB001566A    68-109
    IPB001566B    142-152
    IPB001566C    167-176
    IPB001566D    187-210


ProDom Summary:  Protein Domain Search
Residues 6-60 are 56% similar to a (METHYLTRANSFERASE PROTEOME RNA COMPLETE) protein domain (PD007501) which is seen in YBJF_HAEIN.

Residues 166-212 are 63% similar to a (METHYLTRANSFERASE COMPLETE PROTEOME RNA TRNA) protein domain (PD004091) which is seen in Q9KL20_VIBCH.

Residues 64-160 are 57% similar to a (METHYLTRANSFERASE RNA PROTEOME COMPLETE) protein domain (PD155875) which is seen in YBJF_HAEIN.



Paralogs:  Local Blast Search
HD0478 is paralogously related to HD1765 (1e-15) and HD0723 (1e-12).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRRALIFLASPHFFAPNFFIFIYAKRISTPQIPLFIRPQGFFQTNPKVAS
QLYATVQQWVKILPINHLWDLFCGVGGFGLHCAKALQDQGKPVTLTGIEI
SAAAIESATQSAQKLALNNVTFASLDAAQFALKDRQQTPELVIVNPPRRG
IGKDLAEFLNQLNIPYLIYSSCNAESMVKDFAYLTHYQLHRVQLFDMFPH
TTHYETVTLLIRK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGGAGAGCCTTGATTTTCTTAGCTTCTCCGCATTTTTTTGCGCCAAA
TTTTTTTATCTTTATCTATGCAAAAAGAATCAGTACCCCACAAATCCCAT
TATTTATCCGTCCACAAGGTTTTTTCCAAACCAATCCCAAAGTAGCTAGC
CAACTTTATGCAACAGTACAACAATGGGTCAAAATATTACCTATTAATCA
TTTATGGGATCTTTTCTGTGGTGTAGGTGGCTTTGGTTTACATTGTGCAA
AAGCCCTACAAGATCAAGGAAAACCGGTCACATTAACAGGCATAGAAATT
TCAGCAGCTGCGATTGAAAGTGCTACACAATCCGCACAAAAATTAGCACT
CAACAATGTAACATTTGCTTCGTTAGATGCTGCACAATTTGCGTTAAAAG
ATAGACAACAAACACCCGAGTTAGTTATTGTCAACCCACCACGGCGTGGC
ATAGGCAAAGATCTTGCCGAATTTTTGAACCAACTCAATATACCTTATCT
AATTTATTCTAGCTGTAACGCTGAAAGTATGGTCAAAGACTTCGCATATT
TAACCCATTATCAATTACATAGAGTTCAATTATTTGATATGTTCCCGCAT
ACTACTCATTATGAAACCGTGACTTTACTCATTCGAAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy