Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR342 IGR335 IGR337 IGR336 IGR338 IGR341 IGR334 IGR343 IGR339 IGR340 trmA, - HD0478 HD0479 eno, - HD0477 HD0480 cyaY, - HD0473 HD0470 lgtB, - HD0472 tpn, - HD0482 tpn, - HD0481 gcp, - HD0471 recQ, - HD0475 trmA, - HD0478 HD0479 eno, - HD0477 HD0480 cyaY, - HD0473 HD0470 lgtB, - HD0472 tpn, - HD0482 tpn, - HD0481 gcp, - HD0471 recQ, - HD0475 Type: tandem, Name:  - 10 trmA, - HD0478 HD0479 eno, - HD0477 HD0480 cyaY, - HD0473 lgtB, - HD0472 tpn, - HD0482 tpn, - HD0481 gcp, - HD0471 recQ, - HD0475 HD0470
* Calculated from Protein Sequence

Gene ID: HD0477

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
eno  

Definition:
enolase/ 2-phosphoglycerate dehydratase

Gene Start:
376456

Gene Stop:
375155

Gene Length:
1302

Molecular Weight*:
45808

pI*:
4.80

Net Charge*:
-13.94

EC:
4.2.1.11  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  
Transcription; Degradation of RNA  

Pathway: pathway table
Glycolysis / Gluconeogenesis
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Leroy A, Vanzo NF, Sousa S, Dreyfus M, Carpousis AJ.
Function in Escherichia coli of the non-catalytic part of RNase E: role in the degradation of ribosome-free mRNA.
Mol Microbiol. 2002 Sep;45(5):1231-43.
PMID: 12207692

Liou GG, Chang HY, Lin CS, Lin-Chao S.
DEAD box RhlB RNA helicase physically associates with exoribonuclease PNPase to degrade double-stranded RNA independent
of the degradosome-assembling region of RNase E.
J Biol Chem. 2002 Oct 25;277(43):41157-62.
PMID: 12181321

Garcia-Alles LF, Erni B.
Synthesis of phosphoenol pyruvate (PEP) analogues and evaluation as inhibitors of PEP-utilizing enzymes.
Eur J Biochem. 2002 Jul;269(13):3226-36.
PMID: 12084063

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 16 to 448 are 90% ( EScore : 0.0 ) identical to sp|P43806|ENO_HAEIN ENOLASE between residues 1 and 436 in [Haemophilus influenzae Rd]
Residues 16 to 448 are 81% ( EScore : 0.0 ) identical to sp|P08324|ENO_ECOLI ENOLASE between residues 1 and 432 in [Escherichia coli]
Residues 16 to 448 are 79% ( EScore : 0.0 ) identical to gb|AAF95589.1| (AE004314) enolase between residues 1 and 433 in [Vibrio cholerae]
Residues 16 to 447 are 79% ( EScore : 0.0 ) identical to emb|CAA57795.1| (X82400) enolase between residues 1 and 431 in [Escherichia coli]
Residues 16 to 443 are 62% ( EScore : 1e-148 ) identical to emb|CAB94910.1| (AJ401152) enolase between residues 1 and 425 in [Enterococcus faecalis]
Residues 16 to 438 are 61% ( EScore : 1e-146 ) identical to emb|CAB84728.1| (AL162756) enolase between residues 1 and 417 in [Neisseria meningitidis]
Residues 16 to 438 are 61% ( EScore : 1e-145 ) identical to gb|AAF41661.1| (AE002477) enolase between residues 1 and 417 in [Neisseria meningitidis MC58]
Residues 16 to 443 are 61% ( EScore : 1e-145 ) identical to sp|P37869|ENO_BACSU ENOLASE between residues 1 and 424 in [Bacillus subtilis]
Residues 16 to 443 are 61% ( EScore : 1e-145 ) identical to pir||A41835 phosphopyruvate hydratase between residues 1 and 424 in [Bacillus subtilis]
Residues 16 to 445 are 59% ( EScore : 1e-140 ) identical to sp|P33675|ENO_ZYMMO ENOLASE between residues 1 and 425 in [Zymomonas mobilis]

COGS Summary:  COGS Search
BeTs to 16 clades of COG0148
COG name: Enolase
Functional Class:  G
The phylogenetic pattern of COG0148 is aMtKYqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000941 (Enolase) with a combined E-value of 3.6e-183.
    IPB000941A    9-22
    IPB000941B    34-55
    IPB000941C    90-135
    IPB000941D    146-182
    IPB000941E    204-235
    IPB000941F    285-302
    IPB000941G    313-348
    IPB000941H    381-418


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD0477 is paralogously related to HD1894 (8e-04).


Pfam Summary:  Pfam Search
Residues 3 to 134 (E-value = 1.1e-68) place HD0477 in the Enolase_N family which is described as Enolase, N-terminal domain (PF03952)
Residues 143 to 432 (E-value = 5.3e-179) place HD0477 in the Enolase_C family which is described as Enolase, C-terminal TIM barrel domain (PF00113)

PDB Hit:
pdb|1PDZ| Mol_id: 1; Molecule: Enolase; Chain: Null; Synonym... 373 2e-104
pdb|4ENL| Enolase (E.C.4.2.1.11) (2-Phospho-D-Glycerate Hydr... 354 1e-098
pdb|1ONE|A Chain A, Yeast Enolase Complexed With An Equilibrium... 353 2e-098

Gene Protein Sequence:
MAKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGLAAAPSGASTGSREALE
LRDGDKSRFLGKGVLKAVAAVNNEIAQAIVGKEGCAQSEIDQTMIDLDGT
ENKSKFGANAILAVSLATAKAAAASKGLPLYAYIAELNGTPGVYSMPLPM
MNIINGGEHADNNVDIQEFMIQPIGAKTLREALRIGAEVFHNLAKVLKAK
GLSTAVGDEGGFAPNLASNADALACIKEAVENAGYVLGKDITLAMDCASS
EFYNKENGLYEMKGEGKSFTSQEFTHYLENLCKEYPIVSIEDGQDESDWD
GFAYQTKILGDKVQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSL
TETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSR
SDRIAKYNQLIRIEEALGEMAPFLGLKAIKGQA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAAAATTGTAAAAGTAATTGGTCGTGAAATTATCGACTCTCGTGG
TAACCCGACGGTTGAAGCTGAAGTTCATTTAGAGGGCGGTTTTGTAGGCT
TAGCGGCTGCTCCGTCTGGTGCATCAACAGGATCACGTGAGGCATTAGAG
TTACGTGACGGCGATAAATCACGTTTTTTAGGTAAAGGCGTATTAAAAGC
GGTTGCGGCAGTAAATAATGAAATTGCGCAAGCAATCGTAGGAAAAGAAG
GTTGCGCACAATCTGAAATCGACCAAACTATGATCGATTTAGATGGTACT
GAAAATAAATCTAAATTCGGTGCGAATGCAATTTTAGCGGTTTCTTTAGC
AACAGCAAAAGCAGCTGCAGCTTCTAAAGGTTTACCATTATATGCTTATA
TTGCAGAATTAAATGGTACACCGGGTGTGTATTCTATGCCATTACCAATG
ATGAATATTATCAATGGCGGTGAGCACGCGGACAACAATGTTGATATTCA
AGAATTTATGATTCAACCTATTGGTGCAAAAACATTACGTGAGGCATTAC
GTATCGGCGCAGAAGTTTTCCATAATTTAGCCAAGGTATTAAAAGCGAAA
GGTTTAAGTACTGCGGTAGGTGATGAAGGTGGTTTCGCACCAAACTTGGC
ATCTAATGCTGATGCTTTAGCTTGTATTAAAGAAGCGGTTGAAAATGCAG
GTTATGTGTTAGGTAAAGATATTACTTTGGCGATGGATTGTGCATCATCC
GAATTCTATAATAAAGAAAATGGTTTATATGAAATGAAAGGTGAGGGTAA
ATCATTCACTTCTCAAGAATTTACTCACTATCTAGAAAATTTATGTAAAG
AATACCCTATTGTTTCTATTGAAGATGGCCAAGATGAATCCGATTGGGAT
GGCTTTGCTTATCAAACTAAGATATTAGGTGATAAAGTCCAATTAGTTGG
CGACGATCTATTTGTTACTAATACCAAAATCTTAAAAGAAGGTATTGAAA
AAGGCATTGCAAATTCTATCTTAATTAAGTTCAATCAGATTGGTTCATTA
ACAGAAACGTTAGCTGCAATTAAAATGGCAAAAGATGCTGGCTATACTGC
CGTTATTTCGCACCGTTCAGGTGAAACTGAAGATGCAACAATTGCTGATT
TAGCCGTCGGCACTGCAGCAGGTCAAATCAAAACAGGATCAATGAGCCGT
TCAGATCGGATCGCTAAATATAATCAATTAATCCGTATTGAAGAAGCATT
AGGCGAAATGGCGCCATTCTTAGGGTTAAAAGCCATTAAAGGTCAAGCAT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy