Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR342 IGR335 IGR337 IGR336 IGR338 IGR341 IGR334 IGR333 IGR339 IGR340 trmA, - HD0478 HD0479 rluD, - HD0469 eno, - HD0477 HD0480 cyaY, - HD0473 HD0470 lgtB, - HD0472 tpn, - HD0481 gcp, - HD0471 recQ, - HD0475 trmA, - HD0478 HD0479 rluD, - HD0469 eno, - HD0477 HD0480 cyaY, - HD0473 HD0470 lgtB, - HD0472 tpn, - HD0481 gcp, - HD0471 recQ, - HD0475 Type: tandem, Name:  - 10 trmA, - HD0478 HD0479 rluD, - HD0469 eno, - HD0477 cyaY, - HD0473 HD0470 lgtB, - HD0472 tpn, - HD0481 gcp, - HD0471 recQ, - HD0475 HD0480
* Calculated from Protein Sequence

Gene ID: HD0475

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
recQ  

Definition:
ATP-dependent DNA helicase

Gene Start:
373281

Gene Stop:
375086

Gene Length:
1806

Molecular Weight*:
68708

pI*:
8.30

Net Charge*:
9.79

EC:
3.6.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Secondary Evidence:
Irino,N., Nakayama,K. and Nakayama,H.
The recQ gene of Escherichia coli K12: primary structure and
evidence for SOS regulation
Mol. Gen. Genet. 205 (2), 298-304 (1986)
Medline: 87115164

Umezu,K., Nakayama,K. and Nakayama,H.
Escherichia coli RecQ protein is a DNA helicase
Proc. Natl. Acad. Sci. U.S.A. 87 (14), 5363-5367 (1990)
Medline: 90319113


Comment:
From Genbank:[gi:2851488]
This enzyme is involved in the recF recombination pathway.Its gene expression is under the regulation of the SOS system.It is a DNA helicase.

For other "rec" genes, see HD0410 (recA), HD1076 (recB), HD1342 (recJ), HD1604 (recO), HD1921 (recG), HD0411 (recX), HD0815 (recN), HD0849 (recF), HD0626 (recD).

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to ATP-dependent DNA helicase (recQ). Residues 8-596 are 68% similar to this enzyme from Haemophilus influenzae Rd (16272669) and residues 4-596 are 60% similar to this enzyme from E.coli (7428315).

COGS Summary:  COGS Search
BeTs to 5 clades of COG0514
COG name: Superfamily II DNA helicases, RecQ family
Functional Class: L
The phylogenetic pattern of COG0514 is ----y--ceB-h-----l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000629 (ATP-dependent helicase, DEAD-box) with a combined E-value of 4.8e-11.
    IPB000629A    17-60
    IPB000629E    288-329


ProDom Summary:  Protein Domain Search
Residues 294-334 are 95% similar to a (HELICASE ATP-BINDING ATP-DEPENDENT RNA DNA PROTEOME) protein domain (PD007610) which is seen in Q9CL21_PASMU.

Residues 12-80 are 69% similar to a (HELICASE ATP-BINDING DNA ATP-DEPENDENT) protein domain (PD100086) which is seen in Q9CEM9_LACLA.

Residues 16-67 are 80% similar to a (HELICASE ATP-BINDING DNA ATP-DEPENDENT PROTEOME) protein domain (PD009997) which is seen in Q9KVF0_VIBCH.

Residues 339-398 are 81% similar to a (HELICASE ATP-BINDING DNA ATP-DEPENDENT) protein domain (PD215317) which is seen in RECQ_HAEIN.

Residues 526-592 are 71% similar to a (HELICASE DNA ATP-BINDING RECQ) protein domain (PD013646) which is seen in Q9L6N8_BBBBB.

Residues 235-293 are 49% similar to a (HELICASE ATP-BINDING DNA RECQ) protein domain (PD338160) which is seen in Q9RUU2_DEIRA.

Residues 528-596 are 81% similar to a (HELICASE RECQ PROTEOME COMPLETE) protein domain (PD299819) which is seen in RECQ_HAEIN.

Residues 235-288 are 62% similar to a (HELICASE ATP-BINDING RNA RNA-BINDING ATP-DEPENDENT) protein domain (PD000033) which is seen in Q9CL21_PASMU.

Residues 80-226 are 65% similar to a (HELICASE ATP-BINDING DNA ATP-DEPENDENT) protein domain (PD003883) which is seen in Q9CL21_PASMU.

Residues 401-501 are 60% similar to a (HELICASE ATP-BINDING DNA PROTEOME) protein domain (PD113042) which is seen in Q9CL21_PASMU.



Paralogs:  Local Blast Search

HD0475 is paralogously related to HD1590 (1e-12), HD0213 (1e-10), HD1921 (3e-04) and HD1602 (0.001).


Pfam Summary:  Pfam Search
Residues 11 to 213 (E-value = 2.5e-40) place HD0475 in the DEAD family which is described as DEAD/DEAH box helicase (PF00270)
Residues 250 to 326 (E-value = 7.8e-28) place HD0475 in the Helicase_C family which is described as Helicase conserved C-terminal domain (PF00271)
Residues 523 to 601 (E-value = 3.4e-28) place HD0475 in the HRDC family which is described as HRDC domain (PF00570)

PDB Hit:
pdb|1FUU|A Chain A, Yeast Initiation Factor 4a >gi|11513345|pdb... 78 2e-015
pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal D... 74 4e-014

Gene Protein Sequence:
MQELFSKAKDVLNNIFGYQHFRNGQQEVIEAVLTGQDCLVIMTTGGGKSL
CYQVPALCLEGITLVISPLISLMKDQVDQLLTYGIEAGYINCSQTFEEQQ
RVEQKALSGQLKLLYLSPEKVMTQAFFSFIFHCKISLIVVDEAHCVSQWG
HDFRPEYALLGRLRKTFVGIPLMALTATADPTTRKDILQHLCLTNPYTYL
GSFDRPNIRYTVQQKFKPLEQLTQFILRQQGKSGIIYCNSRKKVEEISEK
LAARKISVMGYHAGMPVQQREMVQEAFQRDNIQIVVATIAFGMGINKSNV
RFVVHFDLPRSIEAYYQETGRAGRDDLPSEAVLFYNPSDYAWMEKTLLEE
PETDQRQIKQHKLQAIGAFAESQTCRRLVLLNYFGESRQAPCQNCDICLN
PPRQYDGTLDAQKVLSVIYRTGQMFGVQHIIAVLRGMNNQRIREFNHDQL
SVYGIGKDQSAPYWLSIIHQLIHLGLIKQNITNHSSLQLTEEARPVLRSQ
KLALAMPRLTFSANAYIQKQASVRYDKDLFARLRFLRKQIADKENIPPYV
VFNDATLQEMAEYLPLSNVEMLEINGVGERKLERFGGAFLNLIKEHCQNR
K$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAGAACTATTTTCTAAGGCAAAAGATGTTTTAAATAACATTTTTGG
TTATCAACATTTCCGCAACGGACAACAAGAAGTTATTGAAGCCGTATTAA
CTGGACAAGATTGTTTAGTTATTATGACAACCGGTGGTGGAAAATCACTT
TGTTATCAAGTCCCTGCACTTTGTCTAGAGGGAATTACATTAGTTATATC
CCCGCTTATTTCGTTGATGAAAGATCAAGTGGATCAATTACTCACTTATG
GTATTGAAGCGGGTTATATCAATTGCTCCCAAACATTTGAAGAGCAACAA
CGTGTCGAACAGAAAGCCTTATCTGGTCAGTTAAAATTACTCTACCTTTC
ACCCGAGAAAGTGATGACCCAAGCTTTCTTTTCTTTTATTTTTCATTGCA
AAATTAGTTTAATTGTCGTTGATGAGGCGCATTGTGTTTCACAGTGGGGG
CATGACTTTCGTCCTGAATATGCATTATTAGGTAGATTACGTAAGACTTT
TGTCGGTATTCCATTAATGGCTTTGACGGCAACCGCTGATCCAACTACGC
GTAAGGATATTCTACAGCATTTATGTTTAACGAATCCTTATACTTACCTA
GGTAGTTTTGATCGGCCTAATATCCGTTATACAGTACAGCAAAAATTTAA
ACCACTAGAACAACTAACGCAATTTATTTTAAGACAGCAGGGGAAAAGCG
GTATTATTTATTGTAATAGCCGCAAAAAAGTTGAAGAAATCAGTGAAAAG
CTTGCAGCACGAAAAATCTCAGTAATGGGATATCACGCAGGAATGCCTGT
ACAACAACGGGAAATGGTCCAAGAAGCGTTTCAGCGAGACAATATCCAAA
TTGTAGTAGCAACAATTGCCTTTGGTATGGGGATTAATAAATCAAATGTA
CGTTTTGTTGTTCATTTTGATTTGCCACGTAGTATTGAGGCCTATTACCA
AGAAACAGGACGAGCAGGGCGTGATGATCTGCCTTCTGAAGCAGTACTAT
TTTACAACCCAAGTGATTATGCTTGGATGGAGAAAACCTTATTAGAAGAG
CCTGAAACAGATCAGCGCCAAATTAAACAACATAAATTACAAGCAATAGG
TGCATTTGCTGAATCGCAAACGTGCCGTCGGTTAGTGTTATTAAATTATT
TTGGCGAATCTCGCCAAGCACCTTGTCAGAATTGTGATATTTGTTTAAAT
CCACCCCGCCAGTATGATGGGACTTTAGATGCACAGAAAGTGTTATCTGT
TATTTATCGTACAGGGCAAATGTTTGGTGTACAGCATATTATTGCCGTGT
TACGTGGAATGAATAATCAAAGAATCCGAGAGTTTAACCACGATCAGCTA
TCTGTCTATGGGATTGGCAAAGATCAATCTGCGCCGTATTGGTTAAGTAT
TATTCATCAACTTATTCATTTAGGTTTAATTAAGCAAAATATTACTAATC
ATTCATCATTACAATTGACAGAAGAAGCACGCCCAGTGTTGCGTTCGCAA
AAATTAGCGTTGGCAATGCCACGCTTAACTTTTTCTGCCAATGCGTATAT
TCAAAAACAAGCCTCAGTGCGTTACGACAAAGATTTATTTGCACGTCTGC
GTTTCTTACGTAAACAGATTGCCGATAAAGAGAATATCCCTCCTTATGTT
GTATTCAATGACGCAACTTTGCAAGAAATGGCGGAATATCTTCCGCTTAG
TAACGTAGAAATGCTAGAAATTAATGGTGTAGGTGAGCGAAAATTAGAGC
GTTTTGGTGGCGCATTTTTGAATTTGATTAAAGAACATTGTCAGAATAGA
AAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy