Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR332 IGR335 IGR337 IGR331 IGR336 IGR338 IGR334 IGR333 IGR339 IGR340 trmA, - HD0478 rluD, - HD0469 eno, - HD0477 cyaY, - HD0473 HD0467 HD0470 lgtB, - HD0472 lgtA, - HD0466 gcp, - HD0471 recQ, - HD0475 trmA, - HD0478 rluD, - HD0469 eno, - HD0477 cyaY, - HD0473 HD0467 HD0470 lgtB, - HD0472 lgtA, - HD0466 gcp, - HD0471 recQ, - HD0475 Type: tandem, Name:  - 10 trmA, - HD0478 rluD, - HD0469 eno, - HD0477 cyaY, - HD0473 HD0467 HD0470 lgtB, - HD0472 lgtA, - HD0466 gcp, - HD0471 recQ, - HD0475
* Calculated from Protein Sequence

Gene ID: HD0472

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lgtB  

Definition:
galactosyltransferase II

Gene Start:
372033

Gene Stop:
372875

Gene Length:
843

Molecular Weight*:
33356

pI*:
8.20

Net Charge*:
4.41

EC:
2.4.1.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Biosynthesis and degradation of glycoprotein
Fructose and mannose metabolism
Glycerolipid metabolism
Peptideglycan biosynthesis
Sphingoglycolipid metabolism

Primary Evidence:
Sun,S., Schilling,B., Tarantino,L., Tullius,M.V., Gibson,B.W. and
Munson,R.S. Jr.
Cloning and characterization of the lipooligosaccharide
galactosyltransferase II gene of Haemophilus ducreyi
J. Bacteriol. 182 (8), 2292-2298 (2000)
MEDLINE: 20200369


Comment:


Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported 6942295 in GenBank.

Matches in gapped BLAST to lipooligosaccharide galactosyltransferase II. Residues 8-255 are 38% similar to this protein from Neisseria meningitidis (15677758|) and residues 8-279 are 40% similar to this protein from H.influenzae (48812|).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB002654 (Glycosyltransferase family 25) with a combined E-value of 2e-77.
    IPB002654A    8-42
    IPB002654B    62-105
    IPB002654C    145-171
    IPB002654D    203-212


ProDom Summary:  Protein Domain Search
Residues 76-280 are identical to a (TRANSFERASE BIOSYNTHESIS) protein domain (PD023344) which is seen in Q9L7A4_HAEDU.

Residues 7-73 are identical to a (TRANSFERASE BIOSYNTHESIS) protein domain (PD004648) which is seen in Q9L7A4_HAEDU.



Paralogs:  Local Blast Search
HD0472 is paralogously related to HD1721 (3e-04).


Pfam Summary:  Pfam Search
Residues 5 to 189 (E-value = 7.2e-87) place HD0472 in the Glyco_transf_25 family which is described as Glycosyltransferase family 25 (LPS biosynthesis protein) (PF01755)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQNIHQHNYVISLKTADARRQHIIQEFAKHNIPFQFFDACSIENNLYMDI
EKHLPMLLNSKLSNSEKGCLMSHFLLWKKCVLDDIPYMTIFEDDIILSDE
SNEFISDYSWVNNRFYEQKEILIKFETFLMPVIRKFTKINEYKERAFNQL
ISRHFGTASYLISKEAAKYLILLYEKLPADELIAVDESIFNVLLNDKNLC
VYQLEPAICVQELQFNKENSLLISQIEEDRYKNQKQNKPRKTLKQRIIKV
CYNINRIFKKIKKTKLSDEKDINSDIVKFK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGAATATACACCAGCATAATTATGTTATTAGTTTAAAAACAGCAGA
TGCGCGTAGGCAACATATTATTCAAGAGTTCGCTAAACACAATATTCCAT
TTCAATTTTTTGATGCTTGTTCAATTGAGAATAATCTTTATATGGATATT
GAAAAACATTTGCCCATGTTATTGAATAGTAAATTAAGTAATAGTGAAAA
AGGATGTTTAATGAGCCACTTCTTATTGTGGAAAAAATGTGTCTTAGATG
ATATTCCTTATATGACTATATTTGAAGATGATATTATTTTAAGCGATGAA
TCAAATGAATTTATATCGGATTATAGTTGGGTTAATAATAGATTTTATGA
GCAAAAAGAAATTCTTATAAAGTTCGAGACTTTTTTAATGCCCGTTATTA
GAAAATTCACAAAAATAAATGAATATAAAGAAAGGGCTTTTAATCAGTTA
ATATCTAGGCATTTTGGCACAGCTAGTTATCTTATTTCAAAAGAAGCAGC
AAAATATTTGATTTTATTATATGAGAAGTTACCTGCTGACGAGCTTATTG
CTGTTGATGAATCTATCTTTAATGTTTTACTTAATGATAAAAATTTATGT
GTTTATCAACTTGAACCTGCAATATGTGTTCAAGAATTACAATTTAATAA
AGAGAATAGTTTATTAATAAGTCAAATTGAAGAAGATAGATATAAAAATC
AAAAACAAAATAAACCTAGAAAAACCTTAAAACAAAGGATTATTAAGGTA
TGTTATAATATTAATAGGATATTTAAGAAAATTAAAAAAACAAAATTAAG
TGATGAAAAAGATATAAACAGTGATATTGTTAAATTTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy