Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR332 IGR335 IGR331 IGR327 IGR328 IGR334 IGR329 IGR330 IGR333 IGR326 rluD, - HD0469 HD0460 HD0467 HD0470 lgtB, - HD0472 HD0459 pfkA, - HD0465 lgtA, - HD0466 gcp, - HD0471 nifS, - HD0464 HD0461 rluD, - HD0469 HD0460 HD0467 HD0470 lgtB, - HD0472 HD0459 pfkA, - HD0465 lgtA, - HD0466 gcp, - HD0471 nifS, - HD0464 HD0461 Type: tandem, Name:  - 10 rluD, - HD0469 HD0467 HD0470 lgtB, - HD0472 HD0459 pfkA, - HD0465 lgtA, - HD0466 gcp, - HD0471 nifS, - HD0464 HD0461 HD0463 HD0463 HD0460
* Calculated from Protein Sequence

Gene ID: HD0466

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lgtA  

Definition:
N-acetylglucosamine glycosyltransferase

Gene Start:
367221

Gene Stop:
368213

Gene Length:
993

Molecular Weight*:
38128

pI*:
10.00

Net Charge*:
11.03

EC:
2.4.1.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Biosynthesis and degradation of glycoprotein
Fructose and mannose metabolism
Glycerolipid metabolism
Peptideglycan biosynthesis
Sphingoglycolipid metabolism

Primary Evidence:
Sun,S., Scheffler,N.K., Gibson,B.W., Wang,J. and Munson Jr,R.S. Jr.
Identification and characterization of the N-acetylglucosamine
glycosyltransferase gene of Haemophilus ducreyi
Infect. Immun. 70 (10), 5887-5892 (2002)
PUBMED: 12228324

Secondary Evidence:
Shao J, Zhang J, Kowal P, Lu Y, Wang PG.
Overexpression and biochemical characterization of
beta-1,3-N-acetylgalactosaminyltransferase LgtD from Haemophilus
influenzae strain Rd.
Biochem Biophys Res Commun. 2002 Jul 5;295(1):1-8.
PMID: 12083757

Yang QL, Gotschlich EC.
Variation of gonococcal lipooligosaccharide structure is due to alterations in poly-G tracts in lgt genes encoding glycosyl transferases.
J Exp Med. 1996 Jan 1;183(1):323-7.
PMID: 8551240

Comment:
0

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported 22759006 in GenBank.


Residues 4 to 321 are 43% ( EScore : 2e-65 ) identical to sp|Q57287|YF78_HAEIN PUTATIVE GLYCOSYL TRANSFERASE HI1578 >1074167|pir||H64130 glycosyl transferase homolog HI1578 between residues 6 and 316 in [Haemophilus influenzae Rd]
Residues 1 to 328 are 42% ( EScore : 1e-63 ) identical to gb|AAA68012.1| (U14554) glycosyl transferase between residues 1 and 336 in [Neisseria gonorrhoeae]
Residues 1 to 250 are 48% ( EScore : 5e-63 ) identical to gb|AAA68009.1| (U14554) glycosyl transferase between residues 1 and 255 in [Neisseria gonorrhoeae]
Residues 1 to 250 are 48% ( EScore : 9e-63 ) identical to emb|CAB83816.1| (AL162753) lacto-N-neotetraose biosynthesis glycosyl tranferase between residues 1 and 253 in [Neisseria meningitidis]
Residues 1 to 250 are 47% ( EScore : 1e-61 ) identical to pir||S70813 glycosyl transferase A between residues 1 and 254 in [Neisseria meningitidis]
Residues 1 to 250 are 48% ( EScore : 1e-61 ) identical to gb|AAF14359.1|AF121135_1 glycosyltransferase between residues 1 and 253 in [Neisseria gonorrhoeae]
Residues 4 to 250 are 48% ( EScore : 3e-61 ) identical to gb|AAA92074.1| (U15992) glycosyltransferase between residues 20 and 269 in [Neisseria gonorrhoeae]
Residues 4 to 250 are 48% ( EScore : 3e-61 ) identical to gb|AAF42258.1| (AE002541) lacto-N-neotetraose biosynthesis glycosyl transferase LgtA between residues 20 and 270 in [Neisseria meningitidis MC58]
Residues 28 to 250 are 45% ( EScore : 3e-52 ) identical to gb|AAF25877.1| (AF208059) LgtA between residues 3 and 228 in [Neisseria gonorrhoeae]
Residues 28 to 250 are 45% ( EScore : 4e-52 ) identical to gb|AAF25876.1| (AF208058) LgtA between residues 3 and 229 in [Neisseria gonorrhoeae]

COGS Summary:  COGS Search
BeTs to 14 clades of COG0463
COG name: Glycosyltransferases involved in cell wall biogenesis
Functional Class:  M
The phylogenetic pattern of COG0463 is AMTKYQVCEBRHujGPo---X
Number of proteins in this genome belonging to this COG is 5

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 28-79 are 51% similar to a (TRANSFERASE PROTEOME COMPLETE GLYCOSYL) protein domain (PD356455) which is seen in Q9L8F0_NEIGO.

Residues 74-214 are 50% similar to a (TRANSFERASE GLYCOSYLTRANSFERASE PROTEOME) protein domain (PD328871) which is seen in Q9CLR9_PASMU.

Residues 5-70 are 69% similar to a (TRANSFERASE COMPLETE PROTEOME GLYCOSYLTRANSFERASE) protein domain (PD000196) which is seen in Q9CLR9_PASMU.

Residues 195-250 are 51% similar to a (TRANSFERASE GLYCOSYL LGTA) protein domain (PD002359) which is seen in Q9EVD5_NEISU.

Residues 84-222 are 50% similar to a (TRANSFERASE GLYCOSYLTRANSFERASE PROTEOME COMPLETE) protein domain (PD023980) which is seen in Q50949_NEIGO.

Residues 85-194 are 45% similar to a (TRANSFERASE GLYCOSYL COMPLETE LGTA) protein domain (PD187371) which is seen in Q50946_NEIGO.



Paralogs:  Local Blast Search
HD0466 is paralogously related to HD0886 (2e-10) and HD0885 (9e-10).


Pfam Summary:  Pfam Search
Residues 6 to 178 (E-value = 2.1e-44) place HD0466 in the Glycos_transf_2 family which is described as Glycosyl transferase (PF00535)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTTLVSVLICAYNVEKYIDECLNAVIAQTYKNLEIIVVNDGSTDGTLAKL
RQFEAKDPRVKIIDNIVNQGTSKSLNIGIQYCQGEIIARTDSDDIVDIHW
IETLMRELDNSPETIAISAYLEFLAEKGNGSKLSRSRKHGKNAENPISSE
AISQRMLFGNPVHNNVALVRRKVFSEYGLRFDPDYIHAEDYKFWFEVSKL
GKMRTYPKALVKYRLHATQVSSAYNQKQRSIAKKIKREAISHYLQQYGIQ
LPEKLTIHDLFSIFSPQIELSLTVANKQELFWSLATSLSEYHFRDLLKIY
SLDIFHQLSFKYKKRIFRKFLLPNRYPSVI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACTTTAGTGTCAGTTTTGATTTGTGCTTATAATGTAGAAAAATA
TATTGATGAATGTTTAAATGCGGTTATTGCGCAAACCTATAAAAACCTTG
AGATTATTGTTGTTAATGATGGTTCAACAGATGGAACATTAGCTAAATTA
CGTCAATTTGAAGCTAAGGATCCAAGAGTCAAGATTATTGATAATATTGT
CAATCAAGGGACGAGTAAATCATTAAATATTGGCATTCAATATTGCCAAG
GGGAAATCATTGCACGTACAGATTCAGATGATATTGTCGATATACATTGG
ATTGAAACATTAATGCGTGAGCTAGATAATTCACCGGAGACGATTGCTAT
TAGTGCTTATTTAGAGTTTTTAGCAGAAAAAGGCAATGGTAGTAAATTAA
GTAGATCGCGTAAGCATGGTAAGAACGCCGAAAATCCAATCTCGTCGGAG
GCAATTAGCCAACGTATGTTATTTGGTAACCCTGTCCATAATAATGTTGC
ATTAGTTCGAAGAAAAGTATTCAGTGAATATGGTTTAAGGTTTGATCCTG
ATTATATTCATGCAGAAGATTATAAGTTTTGGTTTGAGGTTTCTAAGCTA
GGTAAAATGAGAACTTATCCTAAGGCATTAGTTAAATATCGATTGCATGC
TACGCAAGTGTCTTCAGCGTATAATCAAAAACAAAGAAGTATTGCTAAAA
AAATCAAACGAGAAGCCATTTCTCATTACTTACAACAATATGGCATTCAG
TTACCGGAAAAATTAACTATACACGATCTGTTTAGTATTTTTAGCCCACA
AATAGAATTAAGCTTAACAGTAGCAAATAAACAAGAATTATTTTGGTCCT
TAGCGACTTCATTATCAGAATATCATTTTCGCGATTTGTTAAAAATCTAT
TCATTGGATATATTTCATCAGCTAAGTTTTAAATATAAGAAACGCATTTT
TAGAAAATTTCTGTTACCCAATAGATATCCGTCTGTTATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy