Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR332 IGR331 IGR327 IGR328 IGR334 IGR325 IGR329 IGR330 IGR333 IGR326 rluD, - HD0469 HD0460 cybC, - HD0457 HD0467 HD0470 HD0459 pfkA, - HD0465 lgtA, - HD0466 gcp, - HD0471 nifS, - HD0464 HD0461 rluD, - HD0469 HD0460 cybC, - HD0457 HD0467 HD0470 HD0459 pfkA, - HD0465 lgtA, - HD0466 gcp, - HD0471 nifS, - HD0464 HD0461 rluD, - HD0469 HD0460 HD0467 HD0470 HD0459 pfkA, - HD0465 lgtA, - HD0466 gcp, - HD0471 nifS, - HD0464 HD0461 HD0463 HD0458 HD0463 cybC, - HD0457 HD0458
* Calculated from Protein Sequence

Gene ID: HD0465

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pfkA  

Definition:
6-phosphofructokinase

Gene Start:
366130

Gene Stop:
367104

Gene Length:
975

Molecular Weight*:
35446

pI*:
6.90

Net Charge*:
-0.57

EC:
2.7.1.11  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Pentose phosphate cycle

Primary Evidence:
Sun,S., Scheffler,N.K., Gibson,B.W., Wang,J. and Munson Jr,R.S. Jr.
Identification and characterization of the N-acetylglucosamine
glycosyltransferase gene of Haemophilus ducreyi
Infect. Immun. 70 (10), 5887-5892 (2002)
PUBMED: 12228324


Secondary Evidence:
Kornberg HL.
Routes for fructose utilization by Escherichia coli.
J Mol Microbiol Biotechnol. 2001 Jul;3(3):355-9. Review.
PMID: 11361065

Wu LF, Reizer A, Reizer J, Cai B, Tomich JM, Saier MH Jr.
Nucleotide sequence of the Rhodobacter capsulatus fruK gene, which encodes fructose-1-phosphate kinase: evidence for a kinase
superfamily including both phosphofructokinases of Escherichia coli.
J Bacteriol. 1991 May;173(10):3117-27.
PMID: 1850730

Comment:
FruA, the 1-phosphofructokinase, was not found.

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported 22759005 in GenBank.

Residues 18 to 336 are 75% ( EScore : 1e-138 ) identical to sp|P43863|K6PF_HAEIN 6-PHOSPHOFRUCTOKINASE between residues 2 and 320 in [Haemophilus influenzae Rd]
Residues 12 to 336 are 71% ( EScore : 1e-134 ) identical to gb|AAF95830.1| (AE004334) 6-phosphofructokinase, isozyme I between residues 7 and 330 in [Vibrio cholerae]
Residues 18 to 336 are 71% ( EScore : 1e-131 ) identical to pir||KIECFA 6-phosphofructokinase between residues 2 and 319 in [Escherichia coli]
Residues 18 to 336 are 72% ( EScore : 1e-131 ) identical to gb|AAD16179.1| (AF098509) phosphofructokinase between residues 2 and 319 in [Enterobacter cloacae]
Residues 18 to 336 are 69% ( EScore : 1e-127 ) identical to sp|P06998|K6P1_ECOLI 6-PHOSPHOFRUCTOKINASE ISOZYME I between residues 2 and 319 in [Escherichia coli]
Residues 18 to 322 are 71% ( EScore : 1e-126 ) identical to pdb|2PFK|D between residues 2 and 305
Residues 18 to 318 are 72% ( EScore : 1e-124 ) identical to pdb|2PFK|C between residues 2 and 301
Residues 18 to 337 are 51% ( EScore : 2e-93 ) identical to sp|O34529|K6PF_BACSU 6-PHOSPHOFRUCTOKINASE between residues 1 and 318 in [Bacillus subtilis]
Residues 18 to 320 are 54% ( EScore : 7e-93 ) identical to sp|P00512|K6PF_BACST 6-PHOSPHOFRUCTOKINASE between residues 1 and 302 in [Bacillus stearothermophilus]
Residues 18 to 320 are 54% ( EScore : 1e-92 ) identical to pdb|4PFK| between residues 1 and 302

COGS Summary:  COGS Search
BeTs to 11 clades of COG0205
COG name: 6-phosphofructokinase
Functional Class:  G
The phylogenetic pattern of COG0205 is ----YqVCebrh--gpOLIN-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000023 (Phosphofructokinase) with a combined E-value of 5.2e-83.
    IPB000023A    6-24
    IPB000023B    68-105
    IPB000023C    142-196
    IPB000023D    246-277


ProDom Summary:  Protein Domain Search
Residues 6-282 are 76% similar to a (KINASE TRANSFERASE PHOSPHOFRUCTOKINASE) protein domain (PD000707) which is seen in K6PF_HAEIN.

Residues 283-323 are 73% similar to a (6-PHOSPHOFRUCTOKINASE TRANSFERASE GLYCOLYSIS) protein domain (PD153805) which is seen in K6P1_ECOLI.



Paralogs:  Local Blast Search
HD0465 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 282 (E-value = 1.3e-175) place HD0465 in the PFK family which is described as Phosphofructokinase (PF00365)

PDB Hit:
pdb|1PFK|A Chain A, Phosphofructokinase (E.C.2.7.1.11) (R-State... 467 1e-132
pdb|2PFK|D Chain D, Phosphofructokinase (E.C.2.7.1.11) 451 4e-128
pdb|2PFK|C Chain C, Phosphofructokinase (E.C.2.7.1.11) 446 1e-126

Gene Protein Sequence:
MAKEIKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEIFGVQDGYYGLYH
DKVIPLDRRSVSEIINRGGTFLGSARFPQFKDIEVRKQAVKILAKYEIDA
LVVIGGDGSYMGAKLLTEEFGYPCIGLPGTIDNDIVGTDYTIGYQTALQT
AVEAIDRLRDTSTSHQRISIVEIMGRHCGDLTISAALAGGCEYIIVPEKG
LDKESLIHSIADNFRKGKRHAIIAITELMTDVHQLARELEEKFGHETRAT
VLGHIQRGGSPCPFDRILASRMGVYAVDLLRQGFGGRCVGIQNEHLVHHD
IIDAINNMRRPFKQDIFEAASKLA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAAAGAAATCAAGAAAATTGCAGTGTTGACCAGTGGTGGTGATGC
TCCTGGTATGAATGCGGCGATTCGTGGTGTGGTTCGAGCAGCATTAAATG
AAGGTCTAGAAATCTTCGGTGTTCAAGATGGCTATTATGGTTTGTATCAC
GATAAAGTGATTCCATTAGATCGCCGTTCTGTCTCGGAAATTATTAACCG
TGGTGGTACTTTTTTAGGTTCGGCACGTTTTCCACAATTTAAAGATATTG
AGGTTCGCAAACAAGCGGTCAAGATTTTAGCAAAATATGAAATTGATGCT
TTGGTGGTGATTGGCGGTGACGGATCTTATATGGGCGCTAAATTACTCAC
GGAAGAATTTGGTTATCCGTGTATAGGCTTGCCGGGCACAATTGATAATG
ATATTGTTGGCACTGATTATACTATTGGTTATCAAACCGCTTTACAAACG
GCCGTTGAGGCAATTGACCGTTTACGCGATACTTCTACCTCACACCAGCG
TATTTCGATTGTAGAAATTATGGGACGCCATTGTGGTGATTTAACCATTA
GTGCAGCATTAGCCGGTGGTTGTGAATATATTATTGTGCCAGAAAAAGGT
TTAGATAAAGAATCGCTTATTCATAGTATTGCTGATAATTTCCGCAAAGG
TAAACGTCACGCAATTATTGCTATTACGGAATTAATGACAGATGTGCATC
AATTGGCAAGAGAATTAGAAGAAAAATTTGGCCATGAAACACGGGCTACC
GTGTTAGGCCATATACAACGAGGGGGTTCACCTTGTCCATTTGATCGTAT
TTTAGCCTCCCGTATGGGAGTCTATGCGGTTGATTTATTACGTCAAGGTT
TTGGTGGTCGTTGTGTCGGCATTCAAAATGAGCATTTAGTGCATCATGAT
ATTATTGATGCAATTAATAATATGCGACGTCCATTTAAACAGGATATATT
TGAAGCGGCTAGTAAATTAGCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy