Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR332 IGR331 IGR327 IGR328 IGR325 IGR329 IGR330 IGR324 IGR333 IGR326 rluD, - HD0469 prtC,yegQ, - HD0455 HD0460 cybC, - HD0457 HD0467 HD0470 HD0459 pfkA, - HD0465 lgtA, - HD0466 nifS, - HD0464 HD0461 rluD, - HD0469 prtC,yegQ, - HD0455 HD0460 cybC, - HD0457 HD0467 HD0470 HD0459 pfkA, - HD0465 lgtA, - HD0466 nifS, - HD0464 HD0461 rluD, - HD0469 prtC,yegQ, - HD0455 HD0460 cybC, - HD0457 HD0467 HD0470 HD0459 pfkA, - HD0465 lgtA, - HD0466 nifS, - HD0464 HD0461 HD0463 HD0458 HD0463 HD0458
* Calculated from Protein Sequence

Gene ID: HD0464

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nifS  

Definition:
aminotransferase nifS protein

Gene Start:
364819

Gene Stop:
366021

Gene Length:
1203

Molecular Weight*:
44289

pI*:
6.20

Net Charge*:
-4.82

EC:
2.6.1.-  

Functional Class:
Other categories; Other  

Pathway: pathway table
Aminophosphonate metabolism
Caprolactam degradation
Histidine metabolism
Lysine biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
Residues 10 to 398 are 53% ( EScore : 1e-115 ) identical to pir||I64114 nifS protein homolog between residues 47 and 436 in [Haemophilus influenzae Rd]
Residues 9 to 400 are 41% ( EScore : 1e-81 ) identical to pir||F65063 hypothetical protein b2810 between residues 9 and 401 in [unidentified]
Residues 6 to 398 are 40% ( EScore : 6e-81 ) identical to gb|AAF95453.1| (AE004301) aminotransferase, class V between residues 5 and 404 in [Vibrio cholerae]
Residues 9 to 398 are 38% ( EScore : 2e-75 ) identical to dbj|BAA75914.1| (AB024602) NIFS-like protein between residues 7 and 400 in [Pseudomonas putida]
Residues 6 to 392 are 36% ( EScore : 2e-67 ) identical to pir||F70019 nifS protein homolog yurW - Bacillus subtilis >2635765|emb|CAB15258.1| between residues 3 and 396 in [Bacillus subtilis]
Residues 6 to 398 are 36% ( EScore : 5e-65 ) identical to pir||H64925 aminotransferase nifS homolog b1680, pyridoxal phosphate-dependent >1742766|dbj|BAA15457.1| between residues 5 and 405 in [Escherichia coli]
Residues 10 to 400 are 33% ( EScore : 6e-61 ) identical to pir||S76601 hypothetical protein - Synechocystis sp. between residues 14 and 415 in [Synechocystis sp.]
Residues 7 to 392 are 34% ( EScore : 1e-59 ) identical to pir||T35993 probable aminotransferase - Streptomyces coelicolor >5459388|emb|CAB50746.1| between residues 11 and 411 in [Streptomyces coelicolor A3(2)]
Residues 24 to 392 are 36% ( EScore : 4e-59 ) identical to pir||D72260 aminotransferase, class V - Thermotoga maritima between residues 24 and 405 in [Thermotoga maritima]
Residues 6 to 391 are 33% ( EScore : 5e-59 ) identical to gb|AAF82074.1|AF232751_2 nifS-like protein between residues 281 and 674 in [Mycobacterium avium subsp. paratuberculosis]

COGS Summary:  COGS Search
BeTs to 10 clades of COG0520
COG name: Selenocysteine lyase
Functional Class: E
The phylogenetic pattern of COG0520 is --t---vcEbrhujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000192 (Aminotransferase class-V) with a combined E-value of 1.2e-06.
    IPB000192A    23-31
    IPB000192B    220-229


ProDom Summary:  Protein Domain Search
Residues 65-135 are 42% similar to a (PYRIDOXAL LYASE CYSTEINE DESULFURASE) protein domain (PD252975) which is seen in CSD_BORBU.

Residues 64-241 are 52% similar to a (AMINOTRANSFERASE PHOSPHATE PYRIDOXAL COMPLETE PROTEOME) protein domain (PD000087) which is seen in CSD_PASMU.

Residues 10-54 are 64% similar to a (LYASE PYRIDOXAL CYSTEINE PHOSPHATE) protein domain (PD007418) which is seen in CSD_HAEIN.

Residues 311-398 are 47% similar to a (LYASE PYRIDOXAL CYSTEINE PHOSPHATE) protein domain (PD006196) which is seen in CSD_PASMU.

Residues 237-298 are 64% similar to a (LYASE PYRIDOXAL CYSTEINE PHOSPHATE) protein domain (PD186234) which is seen in CSD_HAEIN.



Paralogs:  Local Blast Search
HD0464 is paralogously related to HD1082 (6e-17).


Pfam Summary:  Pfam Search
Residues 32 to 387 (E-value = 9e-11) place HD0464 in the Aminotran_5 family which is described as Aminotransferase class-V (PF00266)

PDB Hit:
pdb|1C0N|A Chain A, Csdb Protein, Nifs Homologue 245 7e-066
pdb|1ECX|B Chain B, Nifs-Like Protein >gi|7546479|pdb|1ECX|A Ch... 98 1e-021
pdb|1EG5|B Chain B, Nifs-Like Protein >gi|7546280|pdb|1EG5|A Ch... 93 5e-020

Gene Protein Sequence:
MNEQLVDGFRQQFPFFTQYAEWSYLDSAATTLKPAVLIEAMSDFYASAGS
VHRSQYDLAQTQDYELARQLVVKWFNVESAEGVIWTSGTTHSTNLVASGL
AYSLNACDEIIISIAEHHANFIPWQQLAMQTQAKLIILPVSANLELTVEQ
LKQVLSTKTKIVALNLVSNVTGIRQPVESLIPIIRQYSSAKILLDCAQAV
CSESIDVQRLGADFYTFSAHKMYGPTGVGVLMGKVQSLAQIRPLFFGGKM
LSDVSIDHLELAELPYRLEAGTPNIAGIIGFGKVLQWLAKWDMDTLNQAV
KQLSIQAYQRLTGYSNIRLFCDKPTTIISFAVDRIHHADIAAIMAESKVA
IRSGEHCAKPYLAHLNQPGTLRISLAPYNQAQDLNRLFEALEVAFTLLAD
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGAACAACTAGTTGATGGATTTAGACAACAATTTCCTTTTTTTAC
GCAGTATGCAGAATGGAGTTATTTAGACTCGGCAGCGACCACCTTAAAAC
CGGCAGTATTAATAGAGGCTATGAGTGATTTTTATGCTTCAGCGGGATCG
GTTCATCGTAGTCAATATGATTTAGCCCAAACGCAAGACTATGAGTTAGC
GCGGCAGTTAGTGGTAAAGTGGTTTAATGTTGAGTCCGCAGAGGGTGTCA
TTTGGACTAGTGGCACAACACATTCTACTAATTTAGTGGCAAGCGGATTA
GCTTATAGTTTAAATGCGTGTGATGAAATTATTATTTCGATTGCAGAGCA
TCACGCTAATTTTATTCCTTGGCAACAGCTTGCTATGCAAACGCAGGCTA
AATTAATTATTTTACCTGTGTCAGCCAATCTTGAGTTAACCGTAGAGCAA
CTAAAGCAGGTATTATCAACCAAAACCAAAATAGTGGCGTTAAATTTGGT
TTCGAATGTGACAGGAATCCGTCAGCCGGTTGAATCGCTGATCCCTATTA
TCCGACAATATTCATCTGCAAAAATTTTGTTAGATTGTGCTCAGGCGGTC
TGTAGTGAAAGTATAGATGTACAGCGGTTAGGTGCCGACTTCTATACATT
TTCCGCACATAAAATGTATGGGCCAACAGGGGTGGGTGTCTTGATGGGCA
AAGTGCAAAGTTTAGCCCAAATTAGACCGCTTTTTTTTGGTGGTAAAATG
CTTAGTGATGTTTCGATTGATCATCTTGAATTAGCAGAGTTGCCTTATCG
TTTAGAAGCCGGTACGCCAAATATTGCTGGTATCATTGGTTTTGGTAAAG
TGTTGCAATGGTTGGCAAAGTGGGATATGGATACATTAAATCAAGCGGTG
AAGCAATTATCCATACAAGCCTATCAACGATTGACAGGCTATTCAAATAT
ACGGTTGTTTTGTGACAAACCCACAACCATTATTAGTTTTGCAGTGGATC
GCATTCATCATGCAGATATTGCTGCGATTATGGCGGAAAGCAAAGTGGCT
ATACGTAGTGGTGAACATTGTGCTAAGCCCTATTTAGCCCATTTAAATCA
GCCGGGTACCTTGAGGATTTCGCTTGCGCCCTATAATCAAGCACAAGATT
TAAACCGCTTATTTGAGGCACTAGAGGTGGCATTTACGCTTTTGGCTGAT
TAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy