Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR322 IGR320 IGR321 IGR327 IGR328 IGR325 IGR329 IGR323 IGR324 IGR326 HD0451 orn, - HD0452 amiB, - HD0450 kdtA,waaA, - HD0454 prtC,yegQ, - HD0455 HD0460 cybC, - HD0457 HD0459 pfkA, - HD0465 nifS, - HD0464 HD0461 HD0451 orn, - HD0452 amiB, - HD0450 kdtA,waaA, - HD0454 prtC,yegQ, - HD0455 HD0460 cybC, - HD0457 HD0459 pfkA, - HD0465 nifS, - HD0464 HD0461 orn, - HD0452 amiB, - HD0450 kdtA,waaA, - HD0454 prtC,yegQ, - HD0455 kdtB,coaD, - HD0453 kdtB,coaD, - HD0453 HD0451 HD0460 cybC, - HD0457 HD0459 pfkA, - HD0465 nifS, - HD0464 HD0461 HD0463 HD0458 HD0463 HD0458
* Calculated from Protein Sequence

Gene ID: HD0457

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cybC  

Definition:
soluble cytochrome b562 precursor (Cytochrome b-562)

Gene Start:
361278

Gene Stop:
361673

Gene Length:
396

Molecular Weight*:
15111

pI*:
5.90

Net Charge*:
-1.52

EC:
 

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table

Secondary Evidence:
Nikkila,H., Gennis,R.B. and Sligar,S.G.
Cloning and expression of the gene encoding the soluble cytochrome
b562 of Escherichia coli
Eur. J. Biochem. 202 (2), 309-313 (1991)
Medline: 92104149

Trower,M.K.
PCR cloning, sequence analysis and expression of the cybC genes
encoding soluble cytochrome b-562 from Escherichia coli B strain
OP7 and K strain NM522
Biochim. Biophys. Acta 1143 (1), 109-111 (1993)
Medline: 93271185

Itagaki,E. and Hager,L.P.
The amino acid sequence of cytochrome b562 of Escherichia coli
Biochem. Biophys. Res. Commun. 32 (6), 1013-1019 (1968)
Medline: 69077911

Mathews,F.S., Bethge,P.H. and Czerwinski,E.W.
The structure of cytochrome b562 from Escherichia coli at 2.5 A
resolution
J. Biol. Chem. 254 (5), 1699-1706 (1979)
Medline: 79109778

Lederer,F., Glatigny,A., Bethge,P.H., Bellamy,H.D. and Matthew,F.S.
Improvement of the 2.5 A resolution model of cytochrome b562 by
redetermining the primary structure and using molecular graphics
J. Mol. Biol. 148 (4), 427-448 (1981)
Medline: 82078041



Comment:


Blast Summary:  PSI-Blast Search
Residues 5-131 are 30% similar to 20455416 Y670_PASMU Hypothetical protein PM0670 precursor.

Residues 8 to 131 are 29% ( EScore : 9e-09 ) identical to sp|P00192|C562_ECOLI SOLUBLE CYTOCHROME B562 PRECURSOR >2144287|pir||CBEC62 cytochrome b562 precursor >41195|emb|CAA47706.1| between residues 5 and 128 in [Escherichia coli, B, Peptide, 128 aa]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0457 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 26 to 131 (E-value = 6.1e-05) place HD0457 in the Cytochrom_B562 family which is described as Cytochrome b562 (PF07361)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MEIFMNKLRAILATSLLSFSTIAFSNSVMMEMSQMNKQLKSLEQAQTSKD
FETIATDFLLVAQKAKETMPASLQDDQERFKGYQAGIQDIIDQVKKAKEL
AEQDKFVDAKELKELVEQLHDLKKKYHLEYK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAATTTTTATGAACAAATTAAGAGCAATTTTAGCTACTTCGTTATT
ATCTTTTTCTACCATCGCTTTTTCAAATAGCGTAATGATGGAAATGTCTC
AAATGAATAAACAGTTAAAGAGTCTAGAACAGGCTCAAACGAGTAAAGAT
TTTGAAACGATAGCTACAGATTTCCTTCTTGTTGCACAAAAAGCAAAAGA
AACGATGCCTGCTAGCCTACAAGATGATCAAGAGCGTTTTAAAGGTTATC
AAGCCGGTATTCAAGATATTATTGATCAAGTTAAGAAAGCTAAAGAGTTA
GCGGAACAAGATAAATTTGTTGATGCAAAAGAACTTAAAGAACTTGTTGA
ACAACTACATGATCTGAAAAAGAAATATCATTTAGAATATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy