Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR322 IGR320 IGR321 IGR327 IGR328 IGR325 IGR319 IGR323 IGR324 IGR326 HD0451 orn, - HD0452 amiB, - HD0450 kdtA,waaA, - HD0454 prtC,yegQ, - HD0455 HD0460 fis, - HD0449 cybC, - HD0457 HD0459 nifS, - HD0464 HD0461 HD0451 orn, - HD0452 amiB, - HD0450 kdtA,waaA, - HD0454 prtC,yegQ, - HD0455 HD0460 fis, - HD0449 cybC, - HD0457 HD0459 nifS, - HD0464 HD0461 HD0451 orn, - HD0452 amiB, - HD0450 kdtA,waaA, - HD0454 prtC,yegQ, - HD0455 kdtB,coaD, - HD0453 kdtB,coaD, - HD0453 HD0460 fis, - HD0449 cybC, - HD0457 HD0459 nifS, - HD0464 HD0461 HD0463 HD0458 HD0463 HD0458
* Calculated from Protein Sequence

Gene ID: HD0455

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
prtC  yegQ  

Definition:
collagenase prtC homolog, possible protease

Gene Start:
361133

Gene Stop:
359730

Gene Length:
1404

Molecular Weight*:
53133

pI*:
7.20

Net Charge*:
1.17

EC:
3.4.-.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Biotin metabolism
Lysine degradation

Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to collagenase prtC homolog, possible protease. Residues 8-465 are 86% similar to this protein from Haemophilus influenzae Rd (1073949|) and residues 2-466 are 75% similar to this protein from Yersinia pestis (16123048|)

COGS Summary:  COGS Search
BeTs to 6 clades of COG0826
COG name: Protease related to collagenase
Functional Class: O
The phylogenetic pattern of COG0826 is -MT--q--EB-huj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001539 (Peptidase family U32) with a combined E-value of 3.9e-64.
    IPB001539A    10-35
    IPB001539B    163-203
    IPB001539C    296-321


ProDom Summary:  Protein Domain Search
Residues 350-456 are 79% similar to a (PROTEASE PROTEOME COMPLETE 3.4.-.-) protein domain (PD040681) which is seen in Q9CP33_PASMU.

Residues 260-349 are 91% similar to a (PROTEASE PROTEOME COMPLETE COLLAGENASE) protein domain (PD004398) which is seen in Q9KU13_VIBCH.

Residues 190-265 are 76% similar to a (PROTEASE PROTEOME COMPLETE 3.4.-.-) protein domain (PD130204) which is seen in YEGQ_HAEIN.



Paralogs:  Local Blast Search
HD0455 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 80 to 356 (E-value = 2e-139) place HD0455 in the Peptidase_U32 family which is described as Peptidase family U32 (PF01136)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTELKYTKPELLSPAGTLKNMRYAFAYGADAVYAGQPRYSLRVRNNEFNH
ANLQIAINEAHQLGKKFYVVVNIAPHNSKLKTFIKDLKVVVDMQPDALIM
SDPGLIMLVRENFPNIDIHLSVQANAVNWATVKFWQKMGLTRVILSRELS
LEEIAEIRQQVPEMELEIFIHGALCMAYSGRCLLSGYINKRDPNQGTCTN
ACRWEYKIEEGKTDEAGNIVPKNTVQQYTPEIQVKNIAPTLGEGAHTDKV
FLYTEPNRPDEQMTAFEDEHGTYFMNSKDLRAVQHVEKLTQMGVHSLKIE
GRTKSFYYCARTAQVYRKAIDDAAMGKPFDPSLMDTLESLAHRGYTEGFL
RRHTHDEYQNYEYGYSISNRQQFVGEFTGKRNTEGLAEVAVKNKFLVGDT
VEIMTPKGNIIFKIERLLNLNRKNESINAGLGDGHFVFLDIPADIDLNFG
LLMRNLTDTNTRNPHKA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGAATTAAAATATACTAAGCCTGAATTACTTTCACCTGCTGGCAC
ATTAAAAAATATGCGTTATGCGTTTGCTTATGGCGCAGACGCCGTTTATG
CAGGCCAACCGCGTTACAGTTTACGCGTGCGAAATAATGAATTTAACCAC
GCCAATTTACAAATTGCGATTAATGAAGCACACCAATTAGGCAAAAAATT
CTATGTTGTAGTCAACATTGCACCTCACAATTCAAAATTAAAGACTTTCA
TTAAAGACTTAAAAGTCGTGGTTGATATGCAACCTGATGCGTTGATTATG
TCCGATCCCGGCTTAATTATGTTAGTAAGAGAAAATTTTCCCAATATTGA
TATTCATCTTTCCGTACAAGCAAATGCAGTTAACTGGGCAACAGTGAAAT
TTTGGCAAAAAATGGGCTTAACTCGGGTTATTTTATCGCGTGAACTGTCT
TTAGAGGAAATTGCTGAAATTCGTCAACAAGTGCCAGAAATGGAATTAGA
AATTTTCATACACGGTGCTTTATGTATGGCATATTCAGGCCGTTGTTTAC
TTTCTGGTTATATTAATAAACGCGATCCAAATCAAGGGACTTGTACCAAC
GCTTGCCGTTGGGAATATAAAATTGAAGAAGGTAAAACCGATGAAGCGGG
CAATATTGTTCCAAAAAATACCGTACAACAATATACACCTGAAATCCAAG
TTAAAAACATTGCGCCAACCTTAGGCGAAGGTGCTCATACAGATAAAGTG
TTTTTATATACCGAACCTAATCGACCAGACGAACAGATGACCGCCTTTGA
AGATGAACATGGCACTTATTTTATGAATTCAAAAGATTTACGTGCTGTGC
AACACGTTGAAAAATTAACGCAAATGGGCGTCCATTCATTGAAAATTGAA
GGGCGCACAAAATCATTTTATTACTGCGCACGTACAGCACAAGTTTATCG
CAAAGCAATTGATGATGCGGCTATGGGCAAGCCATTCGACCCATCATTGA
TGGATACCTTAGAATCACTTGCTCACCGTGGCTATACTGAAGGATTCTTG
CGCCGCCATACACACGATGAATATCAAAATTATGAATACGGTTATTCTAT
TTCCAATCGCCAACAATTTGTTGGAGAGTTTACCGGCAAACGAAATACTG
AAGGTTTAGCAGAAGTCGCCGTAAAAAATAAATTCTTAGTTGGTGATACC
GTTGAAATAATGACGCCAAAAGGTAATATTATTTTTAAAATTGAACGCCT
GTTAAATCTAAATCGTAAAAACGAAAGCATTAACGCAGGCTTAGGCGATG
GCCATTTTGTTTTTCTTGATATACCTGCTGATATTGATCTAAATTTTGGC
TTATTAATGCGTAATCTGACCGATACTAATACACGTAATCCACATAAAGC
CTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy