Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR322 IGR320 IGR318 IGR321 IGR325 IGR316 IGR319 IGR323 IGR324 IGR317 IGR326 HD0451 orn, - HD0452 amiB, - HD0450 kdtA,waaA, - HD0454 prtC,yegQ, - HD0455 pykA, - HD0446 fis, - HD0449 cybC, - HD0457 sixA, - HD0447 HD0459 HD0448 HD0451 orn, - HD0452 amiB, - HD0450 kdtA,waaA, - HD0454 prtC,yegQ, - HD0455 pykA, - HD0446 fis, - HD0449 cybC, - HD0457 sixA, - HD0447 HD0459 HD0448 HD0451 orn, - HD0452 amiB, - HD0450 kdtA,waaA, - HD0454 prtC,yegQ, - HD0455 pykA, - HD0446 kdtB,coaD, - HD0453 kdtB,coaD, - HD0453 fis, - HD0449 cybC, - HD0457 sixA, - HD0447 HD0459 HD0448 HD0458 HD0458
* Calculated from Protein Sequence

Gene ID: HD0453

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
kdtB  coaD  

Definition:
phosphopantetheine adenylyltransferase

Gene Start:
358300

Gene Stop:
357815

Gene Length:
486

Molecular Weight*:
17903

pI*:
7.70

Net Charge*:
1.14

EC:
2.7.7.3  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Pantothenate and CoA biosynthesis

Secondary Evidence:
Roncero,C. and Casadaban,M.J. Genetic analysis of the genes involved in synthesis of the lipopolysaccharide core in Escherichia coli K-12: three operons in the rfa locus
J. Bacteriol. 174 (10), 3250-3260 (1992)
Medline: 92250420

Clementz,T. and Raetz,C.R.
A gene coding for 3-deoxy-D-manno-octulosonic-acid
transferase in Escherichia coli. Identification, mapping, cloning, and sequencing
J. Biol. Chem. 266 (15), 9687-9696 (1991)
Medline: 91236744

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 4 to 157 are 55% ( EScore : 4e-44 ) identical to sp|P44805|COAD_HAEIN PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE between residues 3 and 156 in [Haemophilus influenzae Rd]
Residues 1 to 157 are 52% ( EScore : 6e-44 ) identical to sp|Q9XC89|COAD_KLEPN PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE between residues 1 and 157 in [Klebsiella pneumoniae]
Residues 1 to 154 are 53% ( EScore : 2e-43 ) identical to sp|P23875|COAD_ECOLI PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE between residues 1 and 154 in [Escherichia coli]
Residues 1 to 154 are 50% ( EScore : 9e-41 ) identical to sp|Q9X980|COAD_SERMA PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE between residues 1 and 154 in [Serratia marcescens]
Residues 5 to 158 are 53% ( EScore : 3e-40 ) identical to gb|AAF93398.1| (AE004112) lipopolysaccharide core biosynthesis protein KdtB between residues 9 and 162 in [Vibrio cholerae]
Residues 6 to 157 are 47% ( EScore : 8e-35 ) identical to sp|Q55235|COAD_SYNP7 between residues 5 and 156
Residues 6 to 157 are 47% ( EScore : 8e-35 ) identical to gb|AAA16170.2| (L19521) ORF2 between residues 4 and 155 in [Synechococcus PCC7942]
Residues 4 to 155 are 48% ( EScore : 2e-34 ) identical to sp|P71154|COAD_CHRVI PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE between residues 3 and 154 in [Allochromatium vinosum]
Residues 6 to 150 are 45% ( EScore : 7e-34 ) identical to sp|Q9ZJE4|COAD_HELPJ PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE between residues 6 and 150 in [Helicobacter pylori J99]
Residues 6 to 150 are 44% ( EScore : 2e-33 ) identical to sp|O26010|COAD_HELPY PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE between residues 6 and 150 in [Helicobacter pylori 26695]

COGS Summary:  COGS Search
BeTs to 9 clades of COG0669
COG name: Phosphopantetheine adenylyltransferase
Functional Class: H
The phylogenetic pattern of COG0669 is -----qvcebrhuj--ol---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** PR01020 (Lipopolysaccharide core biosynthesis protein signature) with a combined E-value of 1.1e-51.
    PR01020A    3-21
    PR01020B    21-42
    PR01020C    50-74
    PR01020D    86-102
    PR01020E    113-135


ProDom Summary:  Protein Domain Search
Residues 4-138 are 56% similar to a (ADENYLYLTRANSFERASE PHOSPHOPANTETHEINE) protein domain (PD004081) which is seen in COAD_PASMU.



Paralogs:  Local Blast Search

HD0453 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 135 (E-value = 8.6e-32) place HD0453 in the CTP_transf_2 family which is described as Cytidylyltransferase (PF01467)

PDB Hit:
pdb|1B6T|A Chain A, Phosphopantetheine Adenylyltransferase In C... 175 2e-045

Gene Protein Sequence:
MSYTVIYAGTFDPITNGHLDIITRATKLFAKVIVAVAQNPTKQPLFSLSE
RTALVAQSCSHLTNVEAVSFSGLLADFARQHHAKALIRGIRGSDDIEYEI
QLSQLNNKLADGLETVFLPPAVEWRYLSSTMIREIYYHQGQVNAFVPTAV
VQALQNRKNNE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTATACTGTTATTTATGCTGGGACATTTGATCCCATTACCAATGG
CCATTTGGATATTATTACTCGAGCCACTAAGCTCTTCGCTAAAGTGATTG
TCGCTGTAGCACAAAACCCGACTAAACAACCGCTCTTTTCTTTATCGGAA
AGAACCGCATTAGTTGCACAAAGCTGTAGCCATTTAACGAATGTAGAAGC
GGTCAGTTTTAGTGGTTTACTTGCTGATTTTGCCCGACAACATCACGCTA
AAGCATTAATTAGAGGCATTCGTGGCAGTGATGATATTGAATACGAAATT
CAACTTTCACAACTAAATAATAAATTAGCAGATGGCTTAGAAACGGTTTT
TCTACCGCCTGCGGTTGAATGGCGTTACTTATCCTCTACAATGATAAGAG
AAATCTATTATCACCAAGGTCAAGTCAACGCTTTTGTACCAACCGCGGTT
GTGCAAGCATTACAAAATAGGAAAAATAATGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy