Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR322 IGR320 IGR318 IGR321 IGR325 IGR316 IGR319 IGR323 IGR324 IGR317 HD0451 orn, - HD0452 amiB, - HD0450 kdtA,waaA, - HD0454 prtC,yegQ, - HD0455 pykA, - HD0446 fis, - HD0449 cybC, - HD0457 sixA, - HD0447 HD0459 HD0448 HD0451 orn, - HD0452 amiB, - HD0450 kdtA,waaA, - HD0454 prtC,yegQ, - HD0455 pykA, - HD0446 fis, - HD0449 cybC, - HD0457 sixA, - HD0447 HD0459 HD0448 HD0451 orn, - HD0452 amiB, - HD0450 kdtA,waaA, - HD0454 prtC,yegQ, - HD0455 pykA, - HD0446 kdtB,coaD, - HD0453 kdtB,coaD, - HD0453 fis, - HD0449 cybC, - HD0457 sixA, - HD0447 HD0459 HD0448 HD0458 HD0458
* Calculated from Protein Sequence

Gene ID: HD0452

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
orn  

Definition:
oligoribonuclease

Gene Start:
357822

Gene Stop:
357271

Gene Length:
552

Molecular Weight*:
21372

pI*:
8.20

Net Charge*:
2.59

EC:
3.1.-.-  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table

Secondary Evidence:
Zhang,X., Zhu,L. and Deutscher,M.P.
Oligoribonuclease is encoded by a highly conserved gene in the
3'-5' exonuclease superfamily
J. Bacteriol. 180 (10), 2779-2781 (1998)
Medline: 98241546


Comment:


Blast Summary:  PSI-Blast Search
Residues 17 to 192 are 81% ( EScore : 2e-82 ) identical to sp|P45340|ORN_HAEIN OLIGORIBONUCLEASE >1074907|pir||C64176 hypothetical protein HI1715 between residues 6 and 181 in [Haemophilus influenzae Rd]
Residues 18 to 192 are 69% ( EScore : 1e-69 ) identical to pir||S56390 hypothetical 23.5K protein between residues 30 and 204 in [Escherichia coli]
Residues 18 to 192 are 69% ( EScore : 1e-69 ) identical to sp|P39287|ORN_ECOLI between residues 7 and 181
Residues 15 to 192 are 66% ( EScore : 2e-68 ) identical to gb|AAF93514.1| (AE004123) oligoribonuclease between residues 4 and 181 in [Vibrio cholerae]
Residues 18 to 190 are 56% ( EScore : 2e-55 ) identical to gb|AAF42197.1| (AE002536) oligoribonuclease between residues 6 and 178 in [Neisseria meningitidis MC58]
Residues 18 to 190 are 55% ( EScore : 2e-55 ) identical to emb|CAB83884.1| (AL162753) putative oligoribonuclease between residues 6 and 178 in [Neisseria meningitidis]
Residues 15 to 187 are 54% ( EScore : 2e-49 ) identical to gb|AAF84066.1|AE003959_8 oligoribonuclease between residues 10 and 182 in [Xylella fastidiosa]
Residues 17 to 191 are 51% ( EScore : 7e-47 ) identical to ref|NP_056338.1|| DKFZP566E144 protein >7512815|pir||T14770 hypothetical protein DKFZp566E144.1 - human >5817183|emb|CAB53690.1| between residues 41 and 216 in [Homo sapiens]
Residues 17 to 191 are 51% ( EScore : 7e-47 ) identical to sp|Q9Y3B8|ORN_HUMAN PROBABLE OLIGORIBONUCLEASE between residues 9 and 184 in [Homo sapiens]
Residues 19 to 191 are 46% ( EScore : 9e-43 ) identical to gb|AAF56185.1| (AE003744) CG10214 gene product between residues 38 and 211 in [Drosophila melanogaster]

COGS Summary:  COGS Search
BeTs to 3 clades of COG1949
COG name: Oligoribonuclease (3'->5' exoribonuclease)
Functional Class: F
The phylogenetic pattern of COG1949 is ----y---e-rh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 7-182 are 81% similar to a (EXONUCLEASE 3.1.-.- OLIGORIBONUCLEASE) protein domain (PD011165) which is seen in ORN_HAEIN.



Paralogs:  Local Blast Search
HD0452 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 172 (E-value = 4.4e-36) place HD0452 in the Exonuc_X-T family which is described as Exonuclease (PF00929)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNKLANQHLIWIDLEMTGLDPNQDRIIEIATIVTDKDLNILAKGPVLAVH
QPNTLLSKMNEWCIKTHTANGLIERVKQSKLTERAAELQTLDFLKQWVMK
GSSPICGNSVAQDKRFLYQYMPDLADYFHYRHLDVSTLKELARRWKPEIL
QQFSKKNSHLALDDIRESIEELKFYREHFIKLA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAATTAGCTAACCAACATTTAATTTGGATCGATTTAGAAATGAC
TGGGCTTGATCCAAACCAAGATAGAATTATTGAAATTGCGACTATTGTGA
CAGATAAAGATCTGAATATTCTCGCCAAAGGACCCGTATTAGCCGTCCAT
CAACCAAACACATTACTCAGTAAAATGAATGAATGGTGCATTAAAACACA
TACCGCAAATGGATTAATTGAACGCGTAAAACAAAGCAAACTGACTGAAC
GAGCAGCTGAATTACAAACACTTGATTTTTTAAAACAGTGGGTAATGAAA
GGCAGTTCACCAATTTGTGGCAATAGCGTCGCACAAGATAAACGCTTCTT
ATATCAATATATGCCTGATTTAGCAGATTATTTCCATTATCGGCATTTAG
ATGTAAGTACTTTGAAAGAACTTGCACGTCGTTGGAAACCAGAGATATTA
CAACAATTCAGCAAAAAAAATAGCCATCTAGCCTTAGATGATATCCGTGA
ATCAATTGAAGAACTAAAGTTCTACCGTGAGCATTTCATTAAGCTAGCAT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy