Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR322 IGR320 IGR318 IGR314 IGR321 IGR315 IGR316 IGR319 IGR313 IGR317 HD0451 orn, - HD0452 tyrC, - HD0443 amiB, - HD0450 opsX, - HD0445 aroF,aroA,aroG, - HD0444 kdtA,waaA, - HD0454 pykA, - HD0446 fis, - HD0449 sixA, - HD0447 HD0448 HD0451 orn, - HD0452 tyrC, - HD0443 amiB, - HD0450 opsX, - HD0445 aroF,aroA,aroG, - HD0444 kdtA,waaA, - HD0454 pykA, - HD0446 fis, - HD0449 sixA, - HD0447 HD0448 HD0451 orn, - HD0452 tyrC, - HD0443 amiB, - HD0450 opsX, - HD0445 aroF,aroA,aroG, - HD0444 kdtA,waaA, - HD0454 pykA, - HD0446 tyrA,pheA,aroQ, - HD0442 kdtB,coaD, - HD0453 kdtB,coaD, - HD0453 tyrA,pheA,aroQ, - HD0442 fis, - HD0449 sixA, - HD0447 HD0448
* Calculated from Protein Sequence

Gene ID: HD0447

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
sixA  

Definition:
phosphohistidine phosphatase sixA

Gene Start:
353548

Gene Stop:
354042

Gene Length:
495

Molecular Weight*:
18657

pI*:
6.80

Net Charge*:
-0.34

EC:
3.1.3.-  

Functional Class:
Regulatory functions; Protein interactions  

Pathway: pathway table
Aminosugars metabolism
Nicotinate and nicotinamide metabolism
Riboflavin metabolism
Thiamine metabolism
Vitamin B6 metabolism

Secondary Evidence:
Matsubara M, Mizuno T.
The SixA phospho-histidine phosphatase modulates the ArcB phosphorelay signal transduction in Escherichia coli.
FEBS Lett. 2000 Mar 24;470(2):118-24.
PMID: 10734219

Matsubara M, Mizuno T.
EnvZ-independent phosphotransfer signaling pathway of the OmpR-mediated osmoregulatory expression of OmpC and OmpF in Escherichia coli.
Biosci Biotechnol Biochem. 1999 Feb;63(2):408-14.
PMID: 10192921

Hamada K, Kato M, Mizuno T, Hakoshima T.
Crystallographic characterization of a novel protein SixA which exhibits phospho-histidine phosphatase activity in the multistep His-Asp phosphorelay.
Acta Crystallogr D Biol Crystallogr. 1999 Jan;55 ( Pt 1):269-71.
PMID: 10089421

Ogino,T., Matsubara,M., Kato,N., Nakamura,Y. and Mizuno,T.
An Escherichia coli protein that exhibits phosphohistidine
phosphatase activity towards the HPt domain of the ArcB sensor
involved in the multistep His-Asp phosphorelay
Mol. Microbiol. 27 (3), 573-585 (1998)
Medline: 98149313


Comment:


Blast Summary:  PSI-Blast Search
Residues 3 to 162 are 42% ( EScore : 7e-28 ) identical to sp|P44164|SIXA_HAEIN PHOSPHOHISTIDINE PHOSPHATASE SIXA HOMOLOG >1074737|pir||B64026 hypothetical protein HI1338 between residues 1 and 156 in [Haemophilus influenzae Rd]
Residues 3 to 149 are 35% ( EScore : 1e-14 ) identical to sp|P76502|SIXA_ECOLI PHOSPHOHISTIDINE PHOSPHATASE SIXA between residues 1 and 136 in [Escherichia coli]
Residues 3 to 149 are 35% ( EScore : 6e-14 ) identical to dbj|BAA16194.1| (D90864) similar to [SwissProt Accession Number P44164] [Escherichia coli] >1799738|dbj|BAA16200.1| between residues 1 and 136 in [Escherichia coli]
Residues 3 to 129 are 40% ( EScore : 2e-12 ) identical to gb|AAF95216.1| (AE004281) phosphohistidine phosphatase between residues 3 and 120 in [Vibrio cholerae]

COGS Summary:  COGS Search
BeTs to 3 clades of COG2062
COG name: Phosphohistidine phosphatase SixA
Functional Class: T
The phylogenetic pattern of COG2062 is a----q-ce-rH---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 3-71 are 48% similar to a (3.1.3.- PHOSPHATASE HYDROLASE) protein domain (PD406892) which is seen in SIXA_HAEIN.



Paralogs:  Local Blast Search
HD0447 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VLMNIWIMRHGEASFNATSDSQRSLTPLGQQMAERQGRWLAERLQAQQQI
LDKILVSPLLRTQQTLTYINKGMQAVNFSQNLSELVEIWQGITPSGNPDN
VKNYLTFLYETGYKNVLIISYLPLVYDLVLSITCQQSHIHFYPAVIAEIA
WQSDFGTLVATQKP$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTGATGAATATTTGGATTATGCGCCATGGTGAAGCAAGCTTTAATGC
AACTTCAGATAGTCAACGCTCACTCACGCCATTAGGGCAGCAAATGGCGG
AACGGCAAGGCAGATGGTTAGCAGAGCGGTTACAAGCACAACAGCAAATA
TTAGATAAGATTTTGGTGAGTCCCTTGTTACGAACTCAACAAACTTTGAC
CTATATCAATAAAGGAATGCAAGCGGTTAATTTTAGTCAAAATTTGTCCG
AGCTCGTTGAAATTTGGCAAGGAATTACCCCATCAGGCAATCCGGATAAT
GTTAAAAATTATTTAACCTTTTTATATGAAACAGGATATAAAAATGTTTT
AATTATTTCGTATCTTCCATTAGTGTACGATTTAGTTTTATCGATAACCT
GTCAACAAAGCCATATTCATTTTTACCCAGCCGTGATAGCAGAAATAGCT
TGGCAATCTGATTTTGGTACGCTTGTTGCGACACAAAAGCCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy