Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR320 IGR318 IGR312 IGR314 IGR321 IGR315 IGR316 IGR319 IGR313 IGR317 HD0451 orn, - HD0452 tyrC, - HD0443 amiB, - HD0450 opsX, - HD0445 aroF,aroA,aroG, - HD0444 pykA, - HD0446 fis, - HD0449 sixA, - HD0447 HD0448 dxs, - HD0441 HD0451 orn, - HD0452 tyrC, - HD0443 amiB, - HD0450 opsX, - HD0445 aroF,aroA,aroG, - HD0444 pykA, - HD0446 fis, - HD0449 sixA, - HD0447 HD0448 dxs, - HD0441 HD0451 orn, - HD0452 tyrC, - HD0443 amiB, - HD0450 opsX, - HD0445 aroF,aroA,aroG, - HD0444 pykA, - HD0446 tyrA,pheA,aroQ, - HD0442 tyrA,pheA,aroQ, - HD0442 fis, - HD0449 sixA, - HD0447 HD0448 dxs, - HD0441
* Calculated from Protein Sequence

Gene ID: HD0446

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pykA  

Definition:
pyruvate kinase II

Gene Start:
353433

Gene Stop:
351994

Gene Length:
1440

Molecular Weight*:
51608

pI*:
7.20

Net Charge*:
0.83

EC:
2.7.1.40  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism

Secondary Evidence:
Gonzalez R, Tao H, Shanmugam KT, York SW, Ingram LO.
Global gene expression differences associated with changes in glycolytic flux and growth rate in Escherichia coli during the fermentation of glucose and xylose.
Biotechnol Prog. 2002 Jan-Feb;18(1):6-20.
PMID: 11822894

Ponce E, Flores N, Martinez A, Valle F, Bolivar F.
Cloning of the two pyruvate kinase isoenzyme structural genes from Escherichia coli: the relative roles of these enzymes in pyruvate biosynthesis.
J Bacteriol. 1995 Oct;177(19):5719-22.
PMID: 7559366

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 1 to 479 are 70% ( EScore : 0.0 ) identical to sp|P43924|KPYK_HAEIN PYRUVATE KINASE between residues 1 and 478 in [Haemophilus influenzae Rd]
Residues 1 to 479 are 68% ( EScore : 0.0 ) identical to sp|P21599|KPY2_ECOLI PYRUVATE KINASE II between residues 1 and 480 in [Escherichia coli]
Residues 1 to 478 are 60% ( EScore : 1e-156 ) identical to gb|AAF95156.1| (AE004275) pyruvate kinase II between residues 1 and 480 in [Vibrio cholerae]
Residues 1 to 478 are 45% ( EScore : 1e-110 ) identical to gb|AAF83634.1|AE003922_4 pyruvate kinase type II between residues 14 and 489 in [Xylella fastidiosa]
Residues 7 to 478 are 45% ( EScore : 1e-103 ) identical to gb|AAF96607.1| (AE004400) pyruvate kinase II between residues 3 and 478 in [Vibrio cholerae]
Residues 5 to 476 are 44% ( EScore : 1e-100 ) identical to dbj|BAA95686.1| (AB042618) pyruvate kinase between residues 1 and 471 in [Hydrogenophilus thermoluteolus]
Residues 1 to 479 are 46% ( EScore : 1e-100 ) identical to emb|CAB83492.1| (AL162752) pyruvate kinase between residues 8 and 490 in [Neisseria meningitidis]
Residues 1 to 479 are 46% ( EScore : 1e-100 ) identical to gb|AAF40552.1| (AE002368) pyruvate kinase II between residues 8 and 490 in [Neisseria meningitidis MC58]
Residues 5 to 476 are 40% ( EScore : 9e-85 ) identical to emb|CAB70653.1| (AL137242) pyruvate kinase between residues 1 and 468 in [Streptomyces coelicolor A3(2)]
Residues 6 to 479 are 40% ( EScore : 2e-83 ) identical to pir||B75251 pyruvate kinase - Deinococcus radiodurans between residues 6 and 474 in [Deinococcus radiodurans]

COGS Summary:  COGS Search
BeTs to 11 clades of COG0469
COG name: Pyruvate kinase
Functional Class:  G
The phylogenetic pattern of COG0469 is -m-kY-vCEbrh--gpo-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001697 (Pyruvate kinase family) with a combined E-value of 7e-148.
    IPB001697A    12-47
    IPB001697B    65-79
    IPB001697C    112-138
    IPB001697D    156-204
    IPB001697E    231-275
    IPB001697F    276-298
    IPB001697G    299-331
    IPB001697H    381-408
    IPB001697H    403-430


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD0446 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 351 (E-value = 2.5e-204) place HD0446 in the PK family which is described as Pyruvate kinase, barrel domain (PF00224)
Residues 362 to 477 (E-value = 7.3e-46) place HD0446 in the PK_C family which is described as Pyruvate kinase, alpha/beta domain (PF02887)

PDB Hit:
pdb|1PKY|A Chain A, Pyruvate Kinase From E. Coli In The T-State... 276 5e-075
pdb|1E0U|A Chain A, Structure R271l Mutant Of E. Coli Pyruvate ... 275 1e-074
pdb|1E0T|A Chain A, R292d Mutant Of E. Coli Pyruvate Kinase >gi... 273 3e-074

Gene Protein Sequence:
MSRKLRRTKIVCTMGPATDRSNNLERIIAAGANMVRMNFSHGVPEDHIER
ANKVREIAARLGKHVAILGDLQGPKIRVSTFKEGKIFLNIGDKFTLDADL
PRGEGDQQVVGLDYKNLPNDVVPGDILLLDDGNVQLKVISVEGAKVHTEV
TLGGPLSNNKGINKLGGGLSAPALTEKDKEDIKLAARIGVDYLAVSFPQS
SQDLHYARQLAEEAGLDAKIVAKVERAETVATEEAMDDIILGADVVMVAR
GDLGVEIGDAALVGVQKRLIRRARKLNRVVITATQMMESMIKKPMPTRAE
VMDVANAVLDGTDAVMLSGETASGDYPVETVKSMAEVCLGAETMPSINIS
RHRMQGKFAAIDEAVAMSAMYTANHLESVSAIIALTHSGETAKLMSRISS
GLPIYALSRNQQALNRTALYRGVTPVYYNEESRTIEGAKKGIALLKEKGY
LMTGDLVLLTQGSESKDGGTNTCRILKVE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAGAAAACTTAGAAGAACCAAAATTGTTTGTACAATGGGGCCTGC
AACTGATCGTAGCAATAATTTGGAAAGAATTATCGCTGCAGGAGCAAACA
TGGTTCGTATGAACTTCTCACACGGCGTGCCTGAAGACCATATTGAACGA
GCAAATAAAGTTCGTGAAATAGCTGCACGCTTGGGTAAACATGTTGCTAT
TTTAGGTGACTTACAAGGTCCAAAAATTCGTGTATCGACGTTCAAAGAAG
GAAAAATTTTCTTAAACATAGGCGATAAATTTACCTTAGATGCTGATTTA
CCTCGTGGTGAAGGAGATCAACAAGTGGTCGGTTTAGATTATAAAAACTT
ACCCAACGATGTCGTACCCGGTGATATCCTTTTATTAGATGATGGTAATG
TACAATTAAAAGTTATTTCTGTAGAGGGTGCTAAAGTACATACTGAAGTC
ACGCTTGGTGGCCCTTTATCAAATAATAAAGGCATTAATAAGTTAGGCGG
TGGTTTATCTGCTCCTGCACTAACGGAAAAAGATAAAGAAGATATTAAAT
TAGCTGCGCGTATCGGTGTAGATTATTTAGCGGTTTCATTTCCACAATCT
AGTCAAGACTTACACTATGCACGTCAATTAGCAGAAGAAGCGGGCTTAGA
TGCCAAAATTGTCGCCAAAGTAGAACGTGCTGAAACTGTAGCAACTGAAG
AAGCAATGGACGATATCATTTTAGGTGCTGATGTGGTGATGGTTGCACGT
GGTGACTTAGGTGTTGAGATTGGTGATGCTGCATTAGTTGGCGTACAAAA
ACGATTAATTCGTCGTGCAAGAAAGTTAAACCGCGTAGTGATCACCGCAA
CTCAAATGATGGAATCAATGATCAAGAAACCAATGCCAACACGTGCTGAA
GTAATGGATGTGGCTAATGCCGTGTTAGATGGCACTGATGCCGTAATGTT
GTCAGGCGAAACTGCAAGCGGTGATTACCCTGTAGAAACTGTTAAATCAA
TGGCAGAAGTCTGTTTAGGTGCAGAAACTATGCCAAGTATTAATATTTCT
CGCCACCGCATGCAAGGCAAATTCGCCGCCATTGATGAAGCCGTTGCAAT
GTCTGCGATGTACACGGCTAACCATCTAGAAAGCGTTTCTGCAATCATTG
CATTGACTCACTCCGGTGAAACGGCAAAATTAATGAGCCGTATTAGTTCT
GGCTTACCAATTTATGCGCTATCACGTAATCAACAAGCATTAAATCGTAC
CGCACTTTATCGTGGTGTAACGCCCGTATACTATAACGAAGAAAGCCGTA
CAATCGAAGGAGCTAAAAAAGGTATTGCATTGCTCAAAGAAAAAGGCTAT
TTGATGACCGGTGATTTAGTCTTATTAACACAAGGTAGCGAATCAAAAGA
TGGCGGTACTAATACTTGTCGAATTTTAAAAGTGGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy