Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR318 IGR312 IGR314 IGR311 IGR315 IGR316 IGR310 IGR313 IGR317 tyrC, - HD0443 opsX, - HD0445 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 pykA, - HD0446 fis, - HD0449 sixA, - HD0447 suhB, - HD0440 HD0448 dxs, - HD0441 tyrC, - HD0443 opsX, - HD0445 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 pykA, - HD0446 fis, - HD0449 sixA, - HD0447 suhB, - HD0440 HD0448 dxs, - HD0441 tyrC, - HD0443 opsX, - HD0445 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 pykA, - HD0446 tyrA,pheA,aroQ, - HD0442 tyrA,pheA,aroQ, - HD0442 sixA, - HD0447 suhB, - HD0440 HD0448 dxs, - HD0441 fis, - HD0449
* Calculated from Protein Sequence

Gene ID: HD0444

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
aroF  aroA  aroG  

Definition:
phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase)

Gene Start:
350808

Gene Stop:
349729

Gene Length:
1080

Molecular Weight*:
39622

pI*:
7.30

Net Charge*:
1.43

EC:
4.1.2.15  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Gerigk M, Bujnicki R, Ganpo-Nkwenkwa E, Bongaerts J, Sprenger G, Takors R.
Process control for enhanced L-phenylalanine production using different recombinant Escherichia coli strains.
Biotechnol Bioeng. 2002 Dec 30;80(7):746-54.
PMID: 12402320

Schmitz M, Hirsch E, Bongaerts J, Takors R.
Pulse experiments as a prerequisite for the quantification of in vivo enzyme kinetics in aromatic amino acid pathway of Escherichia
coli.
Biotechnol Prog. 2002 Sep-Oct;18(5):935-41.
PMID: 12363343

Comment:
For other "aro" genes, see HD1274 (aroC), HD1383 (aroA), HD1475 (aroG), HD0415 (aroE), HD0422 (aroB), HD0423 (aroK), HD0632 (aroQ).

Blast Summary:  PSI-Blast Search
Residues 6-352 are 70% similar to 15602530 AroF Pasteurella multocida. Residues 7-344 are 67% similar to 16130522
3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
(DAHP synthetase, tyrosine repressible) [Escherichia
coli K12].

COGS Summary:  COGS Search
BeTs to 7 clades of COG0722
COG name: DAHP synthase/3-Deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
Functional Class:  E,M
The phylogenetic pattern of COG0722 is ----YqvcEb-Huj----INx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB001785 (DAHP synthetase class I) with a combined E-value of 5.8e-174.
    IPB001785A    11-34
    IPB001785B    45-78
    IPB001785C    94-134
    IPB001785D    142-193
    IPB001785E    212-240
    IPB001785F    267-310
    IPB001785G    326-347
    IPB001785B    48-81


ProDom Summary:  Protein Domain Search
Residues 12-352 are 70% similar to a (ALDOLASE PHOSPHO-2-DEHYDRO-3-DEOXYHEPTONATE DAHP) protein domain (PD005060) which is seen in Q9CMY5_PASMU.



Paralogs:  Local Blast Search
HD0444 is paralogously related to HD1475 (1e-83).


Pfam Summary:  Pfam Search
Residues 30 to 345 (E-value = 5.4e-143) place HD0444 in the DAHP_synth_1 family which is described as DAHP synthetase I family (PF00793)

PDB Hit:
pdb|1GG1|A Chain A, Crystal Structure Analysis Of Dahp Synthase... 355 5e-099

Gene Protein Sequence:
VDSVANQDSLHNVNISTEKVLLTPKQLKTEFPLPDHLRKQIEKSRQEIAA
IIHKKDPRKLIIIGPCSIHDISAALEYGQKLKKLADQVSDQLYIVMRVYF
EKPRTTVGWKGLINDPQIDGTFNVEAGLRIARKLCLDLTELGLPLATEAL
DPMTPQYLADLFSWSAIGARTTESQTHRELASGLSMAVGFKNGTDGGLAV
AINAMQSAAQPHRFIGINQNGQVNLLNTKGNPDGHVILRGGKKPNFEQKY
VMECETALRKAGLEEAIMIDCSHGNSNKDHTRQPIVAENVLTQLLAGNRS
IIGLMIESHLNAGNQPSEQSFQEMKYGISITDACIDWQTTEHILLNFAAK
LRNPPSSFQ$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGATTCTGTAGCAAATCAAGATAGTTTACATAATGTAAATATCTCTAC
TGAAAAAGTATTACTTACTCCAAAACAACTAAAAACTGAGTTTCCATTAC
CCGATCATTTACGTAAGCAAATTGAAAAATCACGCCAAGAAATTGCCGCG
ATTATTCATAAAAAAGATCCACGTAAACTTATTATCATCGGACCTTGTTC
TATTCACGATATCTCTGCCGCATTAGAGTATGGCCAAAAACTAAAAAAAT
TAGCCGACCAAGTAAGCGATCAACTTTATATTGTAATGCGGGTATATTTT
GAAAAACCGCGCACCACCGTAGGATGGAAGGGCTTAATTAACGATCCACA
AATAGATGGCACTTTTAATGTTGAAGCCGGTTTACGCATTGCACGTAAAT
TGTGCTTAGATTTAACTGAACTAGGCTTACCATTAGCCACAGAAGCACTA
GATCCAATGACACCACAATATTTAGCAGATCTTTTTAGCTGGTCAGCGAT
TGGAGCAAGAACGACTGAATCACAAACACATCGTGAATTAGCTTCTGGTT
TATCTATGGCCGTTGGCTTTAAAAATGGCACTGATGGCGGCCTAGCTGTG
GCGATTAACGCCATGCAATCTGCCGCACAACCGCATCGTTTCATTGGTAT
CAATCAAAATGGACAGGTCAATTTATTAAATACCAAAGGGAATCCTGATG
GCCACGTGATTTTACGTGGCGGTAAAAAACCTAACTTTGAACAAAAATAT
GTAATGGAATGTGAAACTGCATTACGTAAAGCGGGTTTAGAAGAAGCAAT
AATGATTGATTGTAGCCACGGTAATTCAAATAAAGATCACACACGTCAAC
CTATAGTTGCAGAAAATGTACTCACGCAATTATTGGCAGGTAACCGATCG
ATCATCGGCTTAATGATTGAAAGCCATTTAAATGCGGGTAATCAGCCCTC
TGAACAATCATTCCAAGAGATGAAATACGGCATATCCATTACAGATGCTT
GTATTGATTGGCAAACCACTGAACATATACTTCTCAACTTCGCCGCAAAA
TTAAGAAATCCCCCATCTTCCTTTCAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy