Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR312 IGR314 IGR311 IGR315 IGR316 IGR309 IGR310 IGR313 IGR317 tyrC, - HD0443 opsX, - HD0445 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 pykA, - HD0446 sixA, - HD0447 pgpA, - HD0437 suhB, - HD0440 dxs, - HD0441 tyrC, - HD0443 opsX, - HD0445 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 pykA, - HD0446 sixA, - HD0447 pgpA, - HD0437 suhB, - HD0440 dxs, - HD0441 tyrC, - HD0443 opsX, - HD0445 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 pykA, - HD0446 tyrA,pheA,aroQ, - HD0442 tyrA,pheA,aroQ, - HD0442 sixA, - HD0447 pgpA, - HD0437 suhB, - HD0440 dxs, - HD0441
* Calculated from Protein Sequence

Gene ID: HD0443

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tyrC  

Definition:
prephenate dehydrogenase

Gene Start:
349550

Gene Stop:
348957

Gene Length:
594

Molecular Weight*:
21948

pI*:
10.00

Net Charge*:
8.28

EC:
1.3.1.12  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Fischer,R.S., Zhao,G. and Jensen,R.A.
Cloning, sequencing, and expression of the P-protein gene (pheA) of Pseudomonas stutzeri in Escherichia coli: implications for
evolutionary relationships in phenylalanine biosynthesis
J. Gen. Microbiol. 137 (Pt 6), 1293-1301 (1991)
Medline: 92013931

Hudson,G.S. and Davidson,B.E.
Nucleotide sequence and transcription of the phenylalanine and
tyrosine operons of Escherichia coli K12
J. Mol. Biol. 180 (4), 1023-1051 (1984)
Medline: 85134883

Comment:


Blast Summary:  PSI-Blast Search
Residues 6 to 186 are 55% ( EScore : 4e-48 ) identical to sp|P43902|TYRA_HAEIN T-PROTEIN [INCLUDES: CHORISMATE MUTASE between residues 60 and 240 in [Haemophilus influenzae Rd]
Residues 1 to 178 are 42% ( EScore : 3e-34 ) identical to gb|AAA24868.1| (M74135) prephenate dehydrogenase between residues 16 and 192 in [Erwinia herbicola]
Residues 1 to 178 are 42% ( EScore : 3e-34 ) identical to sp|Q02287|TYRA_ERWHE T-PROTEIN [INCLUDES: CHORISMATE MUTASE between residues 53 and 229 in [Erwinia herbicola]
Residues 1 to 186 are 39% ( EScore : 4e-34 ) identical to gb|AAF93861.1| (AE004155) chorismate mutase/prephenate dehydrogenase between residues 53 and 237 in [Vibrio cholerae]
Residues 1 to 178 are 42% ( EScore : 5e-33 ) identical to dbj|BAA16485.1| (D90888) CHORISMATE MUTASE between residues 30 and 206 in [Escherichia coli]
Residues 1 to 178 are 42% ( EScore : 5e-33 ) identical to sp|P07023|TYRA_ECOLI T-PROTEIN [INCLUDES: CHORISMATE MUTASE between residues 53 and 229 in [Escherichia coli]
Residues 92 to 181 are 39% ( EScore : 1e-09 ) identical to sp|Q58029|Y612_METJA HYPOTHETICAL PROTEIN MJ0612 >2127810|pir||D64376 chorismate mutase between residues 65 and 156 in [Methanococcus jannaschii]
Residues 91 to 165 are 42% ( EScore : 6e-08 ) identical to pir||C69086 chorismate mutase - Methanobacterium thermoautotrophicum between residues 67 and 143 in [Methanobacterium thermoautotrophicum]

COGS Summary:  COGS Search
BeTs to 6 clades of COG0287
COG name: Prephenate dehydrogenase
Functional Class: E
The phylogenetic pattern of COG0287 is amt-yqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 99-178 are 70% similar to a (DEHYDROGENASE PREPHENATE PROTEOME) protein domain (PD356257) which is seen in TYRA_HAEIN.



Paralogs:  Local Blast Search
HD0443 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VLANCRQYAEKLGISSDFIEDILRRVMRESYVNENKFGFKKTNPLIQKIV
IVGGKGKLGGLFGSFLKQSGYYIEILDQQDWPNAEQIIANSDVIIVCVPI
ASTLETLERLAPYLTPNMLLADLTSVKTAPLKKMLAVHRGAVIGLHPMFG
PDIPNMAKQVVLCCPGRFADQYEGYLNKYGFGAQKLKLLKQKNTIKL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTGGCTAATTGCCGACAATATGCTGAAAAGTTAGGCATTTCAAGCGA
TTTTATCGAAGATATCTTAAGAAGAGTGATGCGAGAATCTTATGTTAATG
AAAATAAATTTGGCTTTAAAAAAACCAATCCTCTTATACAAAAAATCGTT
ATTGTCGGCGGAAAAGGTAAGCTAGGTGGATTATTTGGATCTTTCCTGAA
GCAATCTGGTTATTATATAGAAATACTCGACCAACAAGATTGGCCTAATG
CTGAACAAATTATTGCAAATAGTGATGTAATTATTGTTTGTGTGCCTATT
GCAAGCACTCTAGAAACCCTAGAACGCTTAGCACCCTATCTCACTCCCAA
TATGCTTTTGGCAGATCTAACTTCAGTAAAAACCGCTCCACTCAAAAAAA
TGTTAGCTGTCCATCGTGGCGCGGTAATAGGCTTACATCCAATGTTTGGT
CCTGATATTCCTAATATGGCAAAACAAGTTGTCTTATGCTGTCCTGGGCG
TTTTGCTGACCAATATGAAGGCTACTTGAACAAATACGGATTTGGGGCGC
AAAAATTGAAGTTATTGAAGCAGAAGAACACGATCAAGCTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy