Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR312 IGR314 IGR311 IGR315 IGR316 IGR309 IGR310 IGR313 tyrC, - HD0443 opsX, - HD0445 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 pykA, - HD0446 sixA, - HD0447 suhB, - HD0440 thiL, - HD0436 dxs, - HD0441 tyrC, - HD0443 opsX, - HD0445 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 pykA, - HD0446 sixA, - HD0447 suhB, - HD0440 thiL, - HD0436 dxs, - HD0441 tyrC, - HD0443 opsX, - HD0445 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 pykA, - HD0446 tyrA,pheA,aroQ, - HD0442 tyrA,pheA,aroQ, - HD0442 sixA, - HD0447 suhB, - HD0440 dxs, - HD0441 pgpA, - HD0437 thiL, - HD0436 pgpA, - HD0437
* Calculated from Protein Sequence

Gene ID: HD0442

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tyrA  pheA  aroQ  

Definition:
chorismate mutase/prephenate dehydrogenase

Gene Start:
348960

Gene Stop:
348586

Gene Length:
375

Molecular Weight*:
14265

pI*:
7.00

Net Charge*:
0.00

EC:
5.4.99.5  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Vincent S, Chen S, Wilson DB, Ganem B.
Probing the overlap of chorismate mutase and prephenate dehydrogenase sites in the escherichia coli T-protein: a
dehydrogenase-selective inhibitor.
Bioorg Med Chem Lett. 2002 Mar 25;12(6):929-31.
PMID: 11958996

Hur S, Bruice TC.
The mechanism of catalysis of the chorismate to prephenate reaction by the Escherichia coli mutase enzyme.
Proc Natl Acad Sci U S A. 2002 Feb 5;99(3):1176-81.
PMID: 11818529

Vincent S, Chen S, Wilson DB, Ganem B.
Probing the overlap of chorismate mutase and prephenate dehydrogenase sites in the escherichia coli T-protein: a
dehydrogenase-selective inhibitor.
Bioorg Med Chem Lett. 2002 Mar 25;12(6):929-31.
PMID: 11958996

Comment:
What in H.influenzae appears to be two enzymes is a single protein in H.ducreyi (there are no paralogs).

Blast Summary:  PSI-Blast Search
Residues 1-122 are 69% similar to 15602529 TyrA [Pasteurella multocida] and 69% similar to 16273204 chorismate mutase /prephenate dehydrogenase (tyrA) from Haemophilus influenzae Rd.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0287
COG name: Prephenate dehydrogenase
Functional Class:  E
The phylogenetic pattern of COG0287 is amt-yqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-104 are 68% similar to a (DEHYDROGENASE PREPHENATE PROTEOME) protein domain (PD356257) which is seen in TYRA_HAEIN.



Paralogs:  Local Blast Search
HD0442 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTYIQALRHFATFSMGLHLSKQPIQLSQLLTLSSPIYHLELVMVGRLFAQ
DGSLYADIISNKPENLAVLKSLQETYETSLAFFLNNDKTTFIETFNKVHK
WFGDYSKQFLKESGTLLQKANDDW$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGTATATACAAGCACTACGCCATTTCGCAACGTTTTCAATGGGCTT
ACACTTATCGAAACAGCCAATACAATTATCGCAATTACTTACTCTCTCTT
CCCCCATTTACCATTTAGAATTAGTGATGGTCGGTCGATTGTTTGCTCAA
GATGGCAGTTTATATGCCGATATCATTTCCAATAAGCCTGAAAATTTAGC
CGTTTTAAAATCGCTTCAAGAAACCTATGAAACGAGCTTAGCATTCTTTT
TAAATAATGATAAAACAACCTTTATTGAAACTTTTAATAAAGTACATAAA
TGGTTTGGTGATTATTCAAAACAGTTCTTAAAAGAAAGTGGCACTTTACT
TCAAAAAGCAAATGATGATTGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy