Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR312 IGR314 IGR308 IGR311 IGR315 IGR309 IGR310 IGR313 tyrC, - HD0443 opsX, - HD0445 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 pykA, - HD0446 nusB, - HD0435 suhB, - HD0440 thiL, - HD0436 dxs, - HD0441 tyrC, - HD0443 opsX, - HD0445 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 pykA, - HD0446 nusB, - HD0435 suhB, - HD0440 thiL, - HD0436 dxs, - HD0441 tyrC, - HD0443 opsX, - HD0445 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 pykA, - HD0446 tyrA,pheA,aroQ, - HD0442 tyrA,pheA,aroQ, - HD0442 nusB, - HD0435 suhB, - HD0440 thiL, - HD0436 dxs, - HD0441 pgpA, - HD0437 pgpA, - HD0437
* Calculated from Protein Sequence

Gene ID: HD0441

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dxs  

Definition:
1-deoxyxylulose-5-phosphate synthase

Gene Start:
346703

Gene Stop:
348556

Gene Length:
1854

Molecular Weight*:
67865

pI*:
6.40

Net Charge*:
-7.09

EC:
4.1.3.37  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Thiamine  

Pathway: pathway table

Secondary Evidence:
Sprenger,G.A., Schorken,U., Wiegert,T., Grolle,S., de Graaf,A.A.,
Taylor,S.V., Begley,T.P., Bringer-Meyer,S. and Sahm,H.
Identification of a thiamin-dependent synthase in Escherichia coli
required for the formation of the 1-deoxy-D-xylulose 5-phosphate
precursor to isoprenoids, thiamin, and pyridoxol
Proc. Natl. Acad. Sci. U.S.A. 94 (24), 12857-12862 (1997)
Medline: 98058734

Kuzuyama,T., Takagi,M., Takahashi,S. and Seto,H.
Cloning and characterization of 1-deoxy-D-xylulose 5-phosphate
synthase from Streptomyces sp. Strain CL190, which uses both the
mevalonate and nonmevalonate pathways for isopentenyl diphosphate
biosynthesis
J. Bacteriol. 182 (4), 891-897 (2000)
Medline: 20115529



Comment:


Blast Summary:  PSI-Blast Search
Residues 3 to 612 are 79% ( EScore : 0.0 ) identical to sp|P45205|DXS_HAEIN 1-DEOXYXYLULOSE-5-PHOSPHATE SYNTHASE between residues 6 and 615 in [Haemophilus influenzae Rd]
Residues 4 to 617 are 70% ( EScore : 0.0 ) identical to sp|P77488|DXS_ECOLI 1-DEOXYXYLULOSE-5-PHOSPHATE SYNTHASE between residues 7 and 620 in [Escherichia coli]
Residues 3 to 613 are 68% ( EScore : 0.0 ) identical to gb|AAF94051.1| (AE004173) 1-deoxyxylulose-5-phosphate synthase between residues 6 and 621 in [Vibrio cholerae]
Residues 6 to 616 are 58% ( EScore : 0.0 ) identical to gb|AAF97240.1|AF282878_1 1-deoxy-D-xylulose 5-phosphate synthase; Dxp between residues 16 and 624 in [Pseudomonas aeruginosa]
Residues 3 to 617 are 55% ( EScore : 0.0 ) identical to emb|CAB83880.1| (AL162753) putative 1-deoxyxylulose-5-phosphate synthase between residues 2 and 631 in [Neisseria meningitidis]
Residues 3 to 617 are 54% ( EScore : 0.0 ) identical to gb|AAF42201.1| (AE002536) 1-deoxyxylulose-5-phosphate synthase between residues 2 and 631 in [Neisseria meningitidis MC58]
Residues 5 to 608 are 54% ( EScore : 0.0 ) identical to gb|AAF85048.1|AE004037_9 deoxyxylulose-5-phosphate synthase between residues 42 and 648 in [Xylella fastidiosa]
Residues 1 to 616 are 49% ( EScore : 1e-167 ) identical to sp|O67036|DXS_AQUAE 1-DEOXYXYLULOSE-5-PHOSPHATE SYNTHASE between residues 1 and 622 in [Aquifex aeolicus]
Residues 6 to 603 are 49% ( EScore : 1e-156 ) identical to gb|AAD56390.2|AF182286_1 1-deoxy-D-xylulose-5-phosphate synthase between residues 68 and 689 in [Artemisia annua]
Residues 3 to 608 are 47% ( EScore : 1e-155 ) identical to sp|P26242|DXS_RHOCA PROBABLE 1-DEOXYXYLULOSE-5-PHOSPHATE SYNTHASE between residues 6 and 621 in [Rhodobacter capsulatus]

COGS Summary:  COGS Search
BeTs to 10 clades of COG1154
COG name: Deoxyxylulose-5-phosphate synthase
Functional Class: H,I
The phylogenetic pattern of COG1154 is -m---qVcebRhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000360 (Transketolase) with a combined E-value of 4.7e-41.
    IPB000360A    45-56
    IPB000360B    371-410
    IPB000360C    422-451
***** IPB001017 (Dehydrogenase, E1 component) with a combined E-value of 5.2e-06.
    IPB001017D    146-184


ProDom Summary:  Protein Domain Search
Residues 357-608 are 83% similar to a (SYNTHASE THIAMINE DEHYDROGENASE PYROPHOSPHATE PYRUVATE) protein domain (PD000580) which is seen in DXS_HAEIN.

Residues 457-537 are 58% similar to a (SYNTHASE 5-PHOSPHATE THIAMINE) protein domain (PD352498) which is seen in DXS_ECOLI.

Residues 317-354 are 89% similar to a (SYNTHASE BIOSYNTHESIS THIAMINE) protein domain (PD378445) which is seen in DXS_PASMU.

Residues 539-612 are 64% similar to a (SYNTHASE BIOSYNTHESIS THIAMINE) protein domain (PD154080) which is seen in DXS_HAEIN.

Residues 306-356 are 52% similar to a (SYNTHASE BIOSYNTHESIS 5-PHOSPHATE) protein domain (PD383839) which is seen in DXS_PSEAE.

Residues 187-232 are 86% similar to a (SYNTHASE BIOSYNTHESIS THIAMINE) protein domain (PD129679) which is seen in DXS_HAEIN.

Residues 91-137 are 70% similar to a (SYNTHASE THIAMINE BIOSYNTHESIS) protein domain (PD003097) which is seen in DXS_BUCAI.

Residues 72-135 are 46% similar to a (SYNTHASE 5-PHOSPHATE THIAMINE) protein domain (PD413067) which is seen in DXS_STRCO.

Residues 527-612 are 37% similar to a (SYNTHASE BIOSYNTHESIS 5-PHOSPHATE) protein domain (PD394106) which is seen in DXS_SYNLE.

Residues 242-300 are 50% similar to a (SYNTHASE 5-PHOSPHATE THIAMINE) protein domain (PD337235) which is seen in DXS_CHLPN.

Residues 7-67 are 78% similar to a (SYNTHASE 5-PHOSPHATE THIAMINE) protein domain (PD005882) which is seen in DXS_HAEIN.



Paralogs:  Local Blast Search
HD0441 is paralogously related to HD1723 (8e-05).


Pfam Summary:  Pfam Search
Residues 317 to 480 (E-value = 1.2e-66) place HD0441 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)
Residues 492 to 608 (E-value = 1e-32) place HD0441 in the Transketolase_C family which is described as Transketolase, C-terminal domain (PF02780)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQNKYPLLSQIDSPEDLRLLGKEDLSALANELRTYLLDSVSQTSGHLASG
LGVVELTVALHYVYQTPFDQLIWDVGHQAYPHKILTGRRDQMHTIRQKNG
IHPFPWREESPYDVLSVGHSSTSISAGLGIAVAAQKENAGRKTVCVIGDG
AITAGMAFEAMNHAGALHTDMLVILNDNEMSISENVGALNNHLARIFSGS
LYTSMRDGSKKVLDKVPTIKNFMKKSEEHMKGVIFSPDSTLFEELGFNYI
GPIDGHNIEELVKTLTNMRELKGPQFLHVRTKKGKGYEPAENDPISYHGV
PRFDPASGKLPQSKIVPTYSDIFGNWLCEMAENDEKIIGITPAMREGSGM
VEFSKRFPTQYFDVAIAEQHAVTFAAGLAIAGYKPVVAIYSTFLQRAYDQ
LIHDIAIQNLPVIFAIDRAGVVGADGQTHQGAFDLSFMRCIPNMTIMCPA
DENEMHQMLYTAYKMQTPTAIRYPRGNARGIALQPMAELAVGKARIIHQG
KKVAILNFGALLSEAQEVAISHNYTLVDMRFVKPLDKTLISELADSHSLL
VTLEENAIQGGAGSAVNEYLQQIGKIKPLVLIGLPDMFIPQSTQQESYAD
FGLDAKGIDQKIKLALS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAATAAATATCCTCTGTTAAGCCAAATTGATTCACCTGAAGATTT
ACGTTTACTTGGAAAAGAAGATTTATCCGCTTTAGCGAATGAGTTACGAA
CTTATTTATTGGATTCAGTAAGCCAAACGAGTGGGCATTTGGCCTCAGGT
TTAGGCGTTGTTGAGCTGACAGTTGCTTTGCATTATGTTTATCAGACACC
TTTTGATCAACTGATTTGGGATGTTGGTCATCAAGCCTATCCGCATAAAA
TTCTTACCGGTCGCCGTGACCAAATGCATACTATTCGCCAAAAAAATGGT
ATCCATCCTTTTCCTTGGCGAGAAGAAAGCCCTTATGATGTGTTAAGTGT
TGGTCATTCTTCTACTTCCATTAGTGCAGGTTTAGGGATTGCTGTTGCCG
CACAAAAAGAGAATGCTGGCCGTAAAACGGTTTGTGTTATTGGTGATGGT
GCTATTACTGCTGGAATGGCGTTCGAAGCGATGAACCACGCGGGTGCATT
ACATACTGATATGTTAGTGATCTTAAATGATAATGAGATGTCAATTTCTG
AAAACGTTGGCGCATTGAATAATCATTTGGCGCGTATTTTTTCAGGGTCA
CTTTATACAAGTATGCGTGATGGTAGTAAAAAAGTCCTTGATAAAGTGCC
GACTATCAAAAACTTCATGAAAAAAAGTGAAGAGCATATGAAAGGTGTGA
TTTTTTCGCCGGATAGTACGCTATTTGAAGAACTTGGCTTTAATTATATT
GGGCCTATTGATGGGCATAATATTGAAGAGTTAGTGAAAACATTGACAAA
TATGCGGGAATTGAAAGGCCCACAATTTTTACATGTTCGCACTAAAAAAG
GGAAAGGCTATGAACCGGCTGAAAATGATCCTATCAGTTATCATGGCGTA
CCTAGGTTTGATCCAGCATCGGGTAAATTACCACAATCAAAAATAGTGCC
AACATATTCTGATATTTTTGGTAATTGGTTATGTGAAATGGCAGAAAATG
ATGAAAAGATCATTGGTATTACACCTGCTATGCGTGAAGGCTCGGGAATG
GTTGAGTTTTCAAAACGTTTTCCTACACAATATTTTGATGTGGCAATTGC
CGAGCAACATGCGGTCACTTTTGCAGCAGGACTAGCCATTGCGGGTTATA
AACCAGTAGTGGCAATTTACTCAACTTTTTTACAACGTGCTTATGATCAA
TTAATTCATGATATAGCTATTCAAAACTTACCGGTAATTTTTGCAATTGA
TCGTGCGGGGGTTGTGGGTGCAGATGGCCAAACTCACCAAGGCGCATTTG
ATTTGAGCTTTATGCGTTGTATTCCTAATATGACCATTATGTGTCCTGCG
GACGAAAATGAGATGCATCAAATGCTTTATACTGCTTATAAAATGCAGAC
ACCAACAGCGATTCGTTACCCACGTGGTAATGCACGCGGCATCGCGTTAC
AACCAATGGCAGAGTTAGCAGTCGGTAAAGCAAGAATCATTCATCAAGGT
AAAAAGGTGGCTATTTTGAATTTTGGCGCATTATTAAGTGAAGCGCAAGA
AGTGGCCATTTCACATAATTACACCTTAGTGGATATGCGTTTTGTTAAAC
CATTAGATAAAACACTGATTAGTGAATTAGCCGACTCACATAGTTTATTG
GTGACGTTAGAAGAAAATGCTATTCAAGGCGGGGCAGGCAGTGCAGTAAA
TGAATATTTACAACAAATAGGCAAAATTAAACCGCTTGTGCTGATTGGGC
TTCCTGATATGTTTATACCGCAATCAACTCAACAAGAGAGTTATGCTGAT
TTTGGTTTAGATGCAAAAGGGATTGATCAGAAAATTAAATTAGCATTATC
ATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy