Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR305 IGR306 IGR312 IGR308 IGR311 IGR309 IGR310 IGR307 IGR313 tyrC, - HD0443 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 HD0433 nusB, - HD0435 HD0432 suhB, - HD0440 thiL, - HD0436 comE, - HD0434 dxs, - HD0441 tyrC, - HD0443 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 HD0433 nusB, - HD0435 HD0432 suhB, - HD0440 thiL, - HD0436 comE, - HD0434 dxs, - HD0441 tyrC, - HD0443 yfiF, - HD0438 aroF,aroA,aroG, - HD0444 tyrA,pheA,aroQ, - HD0442 tyrA,pheA,aroQ, - HD0442 nusB, - HD0435 suhB, - HD0440 thiL, - HD0436 comE, - HD0434 dxs, - HD0441 HD0431 pgpA, - HD0437 pgpA, - HD0437 HD0432 HD0433 HD0431
* Calculated from Protein Sequence

Gene ID: HD0438

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
yfiF  

Definition:
tRNA/rRNA methylase

Gene Start:
345679

Gene Stop:
344630

Gene Length:
1050

Molecular Weight*:
39437

pI*:
10.60

Net Charge*:
23.94

EC:
2.1.1.-  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 20 to 344 are 51% ( EScore : 6e-88 ) identical to spP44703YFIF_HAEIN HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE HI0424 >gi1074402pirD64152 hypothetical protein HI0424 between residues 17 and 349 in [Haemophilus influenzae Rd]
Residues 102 to 345 are 38% ( EScore : 1e-46 ) identical to spP33635YFIF_ECOLI HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE YFIF >gi7449751pirD65036 hypothetical 37.8 kD protein in ung 3-prime region between residues 97 and 341 in [Escherichia coli]
Residues 102 to 304 are 41% ( EScore : 2e-44 ) identical to dbjBAA16467.1 (D90886) similar to [SwissProt Accession Number P33635]~start codon is not identified yet between residues 125 and 326 in [Escherichia coli]
Residues 107 to 267 are 28% ( EScore : 6e-13 ) identical to pirH71372 conserved hypothetical protein TP0054 - syphilis spirochete >gi3322312gbAAC65050.1 between residues 20 and 184 in [Treponema pallidum]
Residues 25 to 285 are 22% ( EScore : 1e-06 ) identical to spP74328Y955_SYNY3 HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE SLR0955 >gi7469455pirS76163 hypothetical protein - Synechocystis sp. between residues 38 and 301 in [Synechocystis sp.]
Residues 144 to 302 are 25% ( EScore : 1e-06 ) identical to pirS77837 hypothetical protein MC105 - Mycoplasma capricolum >gi530425embCAA83745.1 between residues 11 and 172 in [Mycoplasma capricolum]
Residues 202 to 297 are 30% ( EScore : 9e-06 ) identical to gbAAF30736.1AE002130_3 rRNA methylase between residues 113 and 208 in [Ureaplasma urealyticum]

COGS Summary:  COGS Search
BeTs to 12 clades of COG0566
COG name: rRNA methylases
Functional Class: J
The phylogenetic pattern of COG0566 is a---YQvCEBRHujgpOLinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001537 (tRNA/rRNA methyltransferase (SpoU)) with a combined E-value of 2.2e-12.
    IPB001537A    205-229
    IPB001537C    329-342


ProDom Summary:  Protein Domain Search
Residues 205-340 are 49% similar to a (METHYLTRANSFERASE 2.1.1.- RIBOSE) protein domain (PD149131) which is seen in YFIF_HAEIN.

Residues 43-204 are 57% similar to a (METHYLTRANSFERASE TRNA/RRNA 2.1.1.-) protein domain (PD022890) which is seen in Q9CJY1_PASMU.



Paralogs:  Local Blast Search
HD0438 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 202 to 341 (E-value = 4.7e-28) place HD0438 in the SpoU_methylase family which is described as SpoU rRNA Methylase family (PF00588)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQYLRRNTNMKIKTNKNTPQFKTVNESQPHKFRTKTHHFNHENGFSTRTR
DAKQEKTETKSHTFSYPAEARKANGTGKVRINVKNNKLATEKKTGPLSPR
APEKIKKNRAEEMKVYGENACLSVFQQRPQAIVRLWATVEGAKKLADELS
YLANQKKAYHIVDRIEMDRVTGTPHHGDICLLVKKSAPFILEGYLNIPRK
RDCLVLLDNIHNAQNIGGIMRTCAFYNVKGIIVENSDTLHSSAAARVAEG
GLEFIRPLESKHKEIALTQLRQAGYQIVHLTRNKQAPSLAKTTLAAKVVF
VLNEIPTQDIAYPNDTTVQLSFENLLNSSLNVTVSAGILLNQWYQTHLI$


Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATATTTACGAAGGAACACCAATATGAAAATAAAAACCAATAAAAA
TACGCCACAATTTAAAACCGTAAATGAGTCGCAACCACATAAATTCCGTA
CTAAAACGCACCATTTCAATCATGAAAACGGTTTTTCAACGCGTACTCGT
GATGCTAAACAAGAGAAGACCGAAACAAAATCGCATACATTCAGCTATCC
CGCTGAAGCACGTAAAGCAAATGGCACAGGCAAAGTGCGAATCAATGTCA
AAAATAATAAATTAGCCACCGAGAAAAAAACAGGGCCTTTATCACCGCGC
GCACCAGAAAAGATTAAGAAAAATCGGGCAGAAGAAATGAAGGTATATGG
TGAGAATGCTTGCCTTAGTGTATTTCAGCAACGTCCACAAGCAATTGTGC
GATTATGGGCAACCGTGGAAGGCGCGAAAAAATTAGCTGATGAGTTAAGC
TATTTAGCTAATCAGAAAAAAGCCTATCATATTGTCGATCGTATAGAAAT
GGATCGGGTAACAGGTACACCACATCACGGCGATATCTGTTTATTAGTTA
AAAAATCTGCCCCCTTTATTTTGGAAGGCTATTTAAACATTCCGCGCAAA
CGTGACTGCTTAGTATTACTGGATAATATTCATAATGCGCAAAATATTGG
TGGAATTATGCGTACTTGTGCTTTCTACAACGTAAAAGGTATTATTGTAG
AAAACAGTGATACTTTACACTCTAGTGCCGCAGCACGTGTTGCAGAAGGT
GGACTAGAATTTATTCGTCCGCTTGAAAGTAAACATAAAGAAATTGCCTT
AACGCAATTACGCCAAGCAGGCTATCAAATAGTACATTTAACGCGCAATA
AGCAAGCACCTTCATTAGCTAAAACAACTTTAGCTGCCAAAGTAGTCTTT
GTCTTAAATGAAATTCCCACACAAGATATTGCATACCCAAACGATACCAC
TGTTCAACTTTCGTTTGAGAATCTACTCAACAGTAGTTTAAATGTTACGG
TCAGCGCAGGTATCCTGTTAAATCAATGGTATCAAACTCACCTTATTTAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy