Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR305 IGR303 IGR306 IGR304 IGR312 IGR308 IGR311 IGR309 IGR310 IGR307 tyrC, - HD0443 yfiF, - HD0438 HD0428 HD0430 HD0433 nusB, - HD0435 comA, - HD0427 HD0432 suhB, - HD0440 thiL, - HD0436 comE, - HD0434 dxs, - HD0441 tyrC, - HD0443 yfiF, - HD0438 HD0428 HD0430 HD0433 nusB, - HD0435 comA, - HD0427 HD0432 suhB, - HD0440 thiL, - HD0436 comE, - HD0434 dxs, - HD0441 yfiF, - HD0438 tyrA,pheA,aroQ, - HD0442 tyrC, - HD0443 tyrA,pheA,aroQ, - HD0442 nusB, - HD0435 comA, - HD0427 suhB, - HD0440 thiL, - HD0436 comE, - HD0434 dxs, - HD0441 HD0429 HD0431 pgpA, - HD0437 pgpA, - HD0437 HD0432 HD0430 HD0433 HD0428 HD0431 HD0429
* Calculated from Protein Sequence

Gene ID: HD0437

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pgpA  

Definition:
phosphatidylglycerophosphatase A

Gene Start:
344006

Gene Stop:
344500

Gene Length:
495

Molecular Weight*:
18483

pI*:
6.80

Net Charge*:
-0.39

EC:
3.1.3.27  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Funk CR, Zimniak L, Dowhan W.
The pgpA and pgpB genes of Escherichia coli are not essential: evidence for a third phosphatidylglycerophosphate phosphatase.
J Bacteriol. 1992 Jan;174(1):205-13.
PMID: 1309518

Icho T.
Membrane-bound phosphatases in Escherichia coli: sequence of the pgpA gene.
J Bacteriol. 1988 Nov;170(11):5110-6.
PMID: 2846510

Comment:
From GenBank (gi:1175729):
PgpA specifically hydrolyzes phosphphatidylglycerophosphate. Its catalytic activity is phosphatidylglycerophosphate + H(2)O = phosphatidylglycerol + phosphate. It is an integral membrane protein, inner membrane (potential).

Blast Summary:  PSI-Blast Search
Residues 18 to 146 are 54% ( EScore : 5e-38 ) identical to sp|P44157|PGPA_HAEIN PHOSPHATIDYLGLYCEROPHOSPHATASE A >1074726|pir||D64025 hypothetical protein HI1306 between residues 17 and 144 in [Haemophilus influenzae Rd]
Residues 19 to 146 are 49% ( EScore : 8e-26 ) identical to gb|AAF40826.1| (AE002394) phosphatidylglycerophosphatase A [Neisseria meningitidis MC58] >7380727|emb|CAB85318.1| between residues 18 and 144 in [Neisseria meningitidis]
Residues 18 to 160 are 39% ( EScore : 9e-23 ) identical to sp|P18200|PGPA_ECOLI PHOSPHATIDYLGLYCEROPHOSPHATASE A >7449391|pir||B64771 phosphatidylglycerophosphatase between residues 22 and 162 in [Escherichia coli]
Residues 18 to 146 are 41% ( EScore : 4e-21 ) identical to gb|AAF95409.1| (AE004298) phosphatidylglycerophosphatase A between residues 15 and 146 in [Vibrio cholerae]
Residues 24 to 164 are 32% ( EScore : 7e-16 ) identical to emb|CAB73598.1| (AL139079) putative phosphatidylglycerophosphatase between residues 9 and 150 in [Campylobacter jejuni]
Residues 19 to 146 are 37% ( EScore : 8e-15 ) identical to pir||C70328 conserved hypothetical protein aq_314 - Aquifex aeolicus >2983008|gb|AAC06620.1| between residues 7 and 129 in [Aquifex aeolicus]
Residues 24 to 146 are 34% ( EScore : 2e-09 ) identical to pir||H71902 phosphatidylglycerophosphatase A - Helicobacter pylori between residues 14 and 133 in [Helicobacter pylori J99]
Residues 24 to 146 are 34% ( EScore : 3e-09 ) identical to pir||A64612 conserved hypothetical integral membrane protein HP0737 - Helicobacter pylori between residues 14 and 133 in [Helicobacter pylori 26695]
Residues 19 to 146 are 29% ( EScore : 1e-08 ) identical to pir||B71635 phosphatidylglycerophosphatase A between residues 10 and 176 in [Rickettsia prowazekii]

COGS Summary:  COGS Search
BeTs to 4 clades of COG1267
COG name: Phosphatidylglycerophosphatase A
Functional Class: I
The phylogenetic pattern of COG1267 is -mtk-q--eB-huj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 18-146 are 54% similar to a (PROTEOME COMPLETE) protein domain (PD016242) which is seen in PGPA_HAEIN.



Paralogs:  Local Blast Search
HD0437 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 162 (E-value = 5.5e-65) place HD0437 in the PgpA family which is described as Phosphatidylglycerophosphatase A (PF04608)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LIISMNKIKKINLKNPIHFLAVGFGAGLIKPAPGTWGSLVGLVVAILLWN
LTASSLFFIMLSTILFIAGCYICRQTSDDLGVHDDGRIVWDEIVAILLMF
AFLPEYNMTAYLMAFVSFRFFDIVKPYPIRYFDEKLTTGLGIMFDDLLAA
IYALILLHFIYSFI$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATCATTTCAATGAATAAAATAAAAAAAATTAATCTAAAAAATCCAAT
TCATTTTTTAGCGGTCGGTTTTGGTGCGGGTTTAATTAAACCTGCACCGG
GTACTTGGGGATCGCTTGTTGGGCTTGTCGTGGCTATTTTATTATGGAAT
TTGACCGCTTCATCGCTATTTTTCATTATGTTAAGTACGATCTTATTTAT
TGCAGGTTGCTATATTTGTCGTCAAACAAGCGATGATCTAGGGGTTCATG
ATGATGGTCGGATTGTATGGGATGAGATAGTCGCCATTTTGTTGATGTTT
GCTTTTTTACCTGAATATAATATGACCGCATATTTAATGGCTTTTGTTAG
TTTTCGTTTTTTTGATATCGTAAAGCCTTACCCTATTCGTTATTTTGATG
AAAAATTAACAACCGGTTTGGGTATTATGTTTGATGATTTACTTGCAGCC
ATTTATGCATTAATTTTGTTACATTTTATTTATTCCTTTATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy